KEGG   Aspergillus fischeri: NFIA_059440Help
Entry
NFIA_059440       CDS       T01070                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00250  Alanine, aspartate and glutamate metabolism
nfi00410  beta-Alanine metabolism
nfi00430  Taurine and hypotaurine metabolism
nfi00650  Butanoate metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NFIA_059440
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NFIA_059440
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFIA_059440
   00430 Taurine and hypotaurine metabolism
    NFIA_059440
Enzymes [BR:nfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NFIA_059440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 4585004
NCBI-ProteinID: XP_001258488
UniProt: A1DP70
LinkDB All DBs
AA seq 515 aa AA seqDB search
MVHLATVKRDSENFEPLVKRVDSIKLETTDDDDFYSTVYGTRFAAEQLPQNEMPEREMPR
EVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMTDSFSKNFIDYEEYPQSAEIQNR
CVNMIARLFNAPIDSDNEHPVGTSTVGSSEAIMLGTLAMKRRWQNKRKAEGKDTTRPNII
MNSAVQVCWEKAARYFDVEERYVYCTEDRYVIDPKQAVDLVDENTIGICAILGTTYTGEY
EDVKAINDLLVERGLDIPIHVDAASGGFVVPFINPNLLWDFRLEKVVSINVSGHKYGLVY
PGVGWVVWRSPEYLPKELIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYRS
IMVNITRIADYLAQQLEQLGFIIMSQQRGRGLPLVAFRLPSDRNEQFDEFALAHQLRERG
WIVPAYTMAPHSNELKLMRVVVREDFSMNRCDALLTDIKLALKTLSDMDKAMLEKYTLHV
QKHAVNSHKSKHNHSHYKNEKHSLQGKTGKTHGVC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtccaccttgctacggtcaagcgcgacagcgaaaattttgaacccctcgttaaacgc
gttgattctatcaagctcgaaaccaccgatgatgacgatttctactccactgtatacggg
actcggtttgcggcggagcagctgccccagaatgagatgcccgagagggagatgccccgt
gaagtcgcttaccgcatgatcaaggatgagcttagtttggatggaaatcctatgctcaat
ttggctagttttgtcacgacgtacatggaagaggaagccgagaagctcatgaccgactct
ttcagcaagaactttatcgattacgaagaatatccccagtccgccgagatccagaaccgg
tgtgtcaacatgatcgctcggctgttcaatgcccctattgacagcgacaacgagcacccc
gtcggcacctcaaccgttggctcgtccgaggccatcatgctgggcacgctggccatgaag
cgacggtggcagaacaagcgcaaggccgagggcaaagacaccacacgccctaacatcatt
atgaacagcgccgtgcaggtctgctgggagaaagccgcgcggtactttgacgtggaggag
cgctacgtctattgtaccgaggaccgctacgtcattgaccccaagcaggccgtcgatctg
gtcgacgagaataccatcggcatctgcgccatcctgggaaccacatacaccggcgagtac
gaagacgtcaaggcgattaatgatcttctggtcgagcgcggcctcgacatccctatccac
gtggacgccgccagcggtggctttgtcgtcccgttcatcaaccccaacctgctgtgggac
tttcgcctggagaaggtcgtttcaatcaacgtgtccggccacaagtacggccttgtctac
cccggcgtgggctgggtcgtctggcgctcacccgaatacctacccaaggagctgatcttc
aacatcaactacctgggcgccgagcaggccagtttcaccctcaatttctccaagggcgct
tcgcaggtcatcggccagtactaccagatgatccggctgggcaagcgcggctaccgctcg
attatggtcaacatcacgcgcattgccgactacctggcacagcaactcgaacagctaggc
ttcatcatcatgagccagcagcgcggccgcggactgcccctcgtggcgttccgcctgcct
tcagaccgcaacgagcagttcgacgagttcgccctggcgcaccaactgcgcgagcggggg
tggatcgtgcccgcgtacacgatggcgccgcacagcaacgagctgaagctgatgcgggtg
gttgtgcgcgaggactttagcatgaaccggtgcgatgctctgctgacggatatcaagctg
gcgctgaagacgttgagcgatatggacaaggccatgctggagaagtatactctacatgtt
caaaagcacgcggttaactcgcacaagtccaagcataaccattcgcactacaagaacgag
aagcattccttgcagggcaagactgggaagacgcacggagtttgctag

DBGET integrated database retrieval system