KEGG   Aspergillus fischeri: NFIA_060440Help
Entry
NFIA_060440       CDS       T01070                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00052  Galactose metabolism
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NFIA_060440
   00500 Starch and sucrose metabolism
    NFIA_060440
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NFIA_060440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 4585101
NCBI-ProteinID: XP_001258585
UniProt: A1DPG7
LinkDB All DBs
AA seq 972 aa AA seqDB search
MVGLSKHMCSLWLVTVAHCLTLPTATKTSASSQYAIPSSASNGQNVLANIEDPEAVDAQG
VCPGYKASGVRQTRSGLTATLELAGKACNVYGTDLDRLNFTVEYQAVDRVNVQIMPANID
TSNSSWYILPESLVPKPKAAGGMSLGSSDLEIAWSNEPTFNFKVTRMATGDVLFNTEGSV
LVFEDQFLEFKSSLPDDYNLYGLGEHITSFRLHNNLTLTTYAVDIGDPFSTNLYGAHPFY
LETRYYEVGSGNRTYTPVSSSTTDRSKKYTSFSHGVYLWNAHGQEVKLQPDSLTWRAIGG
SIDLYFYANPSQAAVTQNYQVSTIGLPAMQQYPTLGYHQSRWGYRNWAELEEVVDNFEKF
KIPLETIWADIDYMNQYRNFENDQNTFGYKEGRKFLNKLHKSGRHYVPILDTGIYVPNSE
NASDAYDTYIRGTADDVWLKNPDSSLYIGSVWPGYTVFTDFLHPKAVDFWANELVKYHER
VAFDGVWMDMNEASSFCVGSCGSNLSTHNPAHPPFKLPGDPGYLLFDYPEGFNITNATEA
ASASAAASSQDAANSATQGPATSTAITYLRTTPTPGVRNINYPPYAINNVQSGHDLAAHA
ISPNASHVDGTLEYDVHNLYGHQVINATYQGLLAISPNKRPFIIGRSTFAGSGQWAGHWG
GDNYAKWAYMYSSIPHALSFSLYGIHELCNRWMQLSAFFPFYRNHNRLAAIPQEPYRWAS
VIKASQDAMKIRYSILPYMYTLMYQAHATGSTVMRALAWEFPDDPSLSAVETQFLLGPAL
MIIPVLVPQANAVKGVFPGLAHGEKWYDWYTQREVLYAQPGKNTTIPAPLGHIPVFVRGG
HVIPMQKPALTTREARNTPWSLLVALDDKGDAAGQLYLDDGESISPEETLTVNLAASSGT
KLVASVAGCWKERNNMDKVTVLGVKKAPSQIRFNGQKVKSAVYNATSQVLSIHGLHEMTR
KGAWEKGWVLAW
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtctctccaagcatatgtgcagcctctggctggttactgttgctcattgcttg
acccttcctactgcgaccaagacctccgcgagttctcagtacgccattccctcttcggcc
tccaacggccagaacgtgcttgccaacattgaggatcccgaagctgttgatgcgcaaggg
gtctgcccgggctacaaggcgtcgggtgtccgccaaaccaggtccggtctaactgccact
ctcgagctggctgggaaggcatgcaacgtttacggaacagacttggatcgtttgaatttc
acggttgagtaccaggcggtcgatcgcgtcaacgttcaaattatgccggctaatattgat
acctccaactcctcttggtatattcttccggaaagcctggttcccaagcccaaagctgcg
ggaggtatgtcactgggcagcagtgacctagagattgcctggtctaatgagcccactttc
aattttaaagtgactcggatggcaaccggtgacgtgctctttaacactgagggcagcgtc
ctggtgtttgaggatcaattcctggagttcaagtcctccctaccggatgactacaacctc
tacggtctgggcgagcacattaccagttttagactgcacaacaacctgaccttgaccacc
tacgcggtggatattggtgacccctttagtacgaacctgtatggcgcccatcccttctac
cttgagactcgatactatgaagttggctcgggtaaccggacgtataccccagtctcaagc
agcactaccgatcgctccaaaaagtacacttcattctcacacggagtgtacctgtggaac
gcacatgggcaggaggtgaagctacagccagacagcctgacttggcgcgccatcggtggc
agtattgatctctacttctatgccaatccttctcaggctgctgtaacccagaattatcag
gtcagcaccattggattacctgccatgcaacaataccccactcttggctatcatcagtct
cgctggggatatcgtaattgggcggagctcgaagaagttgtggacaatttcgagaagttc
aagattccgttggagactatctgggctgatatcgactatatgaaccagtaccgcaacttt
gaaaacgaccagaacactttcgggtacaaagagggtaggaaattcttgaacaaactgcac
aagagcggccgccactatgtgcctattctcgataccggtatctacgtgccaaactctgag
aatgcttccgatgcttatgatacctatatcaggggtacagcggatgatgtctggctcaag
aacccggacagcagtctgtatatcggctctgtgtggcctggatacaccgttttcacggat
ttccttcatcccaaagcggtggacttttgggctaacgaactggtcaaataccatgagagg
gtagcctttgacggcgtctggatggatatgaacgaggcttcttcattctgcgtgggcagc
tgcgggtctaacctcagtactcacaatcctgcccatccccctttcaagctacccggtgat
cccggatatcttctgttcgactatcctgaaggattcaacatcacaaacgctacggaagcc
gcctcagcatcggcagctgcttcaagccaggacgcggccaattctgctactcaaggccct
gccacgtccacggcgatcacctatctacgtacaactcctactcctggtgtccgcaatatc
aactacccgccttacgcgataaataacgtccaatccggccacgacctggcagcccatgcc
atctcccccaacgccagccacgtcgatggaactctcgaatacgacgtccacaacctgtac
gggcaccaagtcatcaacgcgacttaccaagggctcctagccatcagtccaaacaaacgc
cccttcattatcggccgctcaactttcgcaggctccggccaatgggctggccactggggc
ggcgacaactacgccaaatgggcatatatgtactcatccatcccccacgccctctccttc
tcgttgtacggaattcatgaactctgcaaccggtggatgcagctctccgcttttttcccg
ttctaccgcaaccacaaccggctggctgctatcccgcaagaaccataccgctgggcctcg
gtcatcaaggcctcgcaagacgcaatgaagatccgttattctattctcccgtatatgtac
acgttgatgtatcaggctcacgccacgggttcgacggtcatgcgcgctctggcatgggag
ttcccagatgatccgtctctgtcggccgtggagacgcagttcctgctcggtccggcctta
atgattattcccgttttagtgccacaagcgaatgcagttaagggagtcttccctggtctg
gcgcacggcgagaagtggtatgactggtacacgcagcgtgaggtgctttatgcccagccg
gggaagaacacgaccatcccggcgccgctggggcatatcccggtatttgttcggggcggg
catgtcattccaatgcagaagccggcgctgacaacacgcgaggcgaggaatacgccatgg
tctttgctggttgcgctggatgacaagggggatgcggcaggccagctttacctggatgat
ggggagagtattagtccggaggaaactcttactgtcaatttagctgcctcgtccggtacg
aagctggttgcatctgtcgctggttgttggaaagaacggaataatatggacaaggtgaca
gttttgggcgtcaagaaggcgccatcgcagatcaggttcaatggccagaaggtcaaatct
gctgtgtacaatgccacttctcaagtcctctcaattcacggtctgcatgagatgaccagg
aagggagcatgggagaagggatgggtgttggcatggtga

DBGET integrated database retrieval system