KEGG   Aspergillus fischeri: NFIA_068460Help
Entry
NFIA_068460       CDS       T01070                                 

Definition
(RefSeq) isocitrate dehydrogenase Idp1, putative
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00020  Citrate cycle (TCA cycle)
nfi00480  Glutathione metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
nfi01210  2-Oxocarboxylic acid metabolism
nfi01230  Biosynthesis of amino acids
nfi04146  Peroxisome
Module
nfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NFIA_068460
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NFIA_068460
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NFIA_068460
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NFIA_068460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4590220
NCBI-ProteinID: XP_001263574
UniProt: A1D7I3
LinkDB All DBs
AA seq 413 aa AA seqDB search
MATEGTKIKVKNPVVELDGDEMTRIIWQEIREKVSPSYLDIDLKYYDLGIEYRDQTDDKV
TVEAAEAIKKYGVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNILGGTVFREPIVIPR
IPRLVPGWNKPIIIGRHAFGDQYRATDIVVPGPGKLELVYTPENGEPQAIKVYDFTGGGV
AQTQYNTDDSIRGFAHSSFKMALMKGLPLYMSTKNTILKKYDGRFKDIFQEIYESTYKKE
FDAKGIWYEHRLIDDMVAQMIKSEGGFVMALKNYDGDVQSDVVAQGFGSLGLMTSTLTTP
DGSAFESEAAHGTVTRHYREHQKGRETSTNPIASIFAWTRGLVQRGKLDETPDVVAFAEE
LERACIDVVNEEGIMTKDLALACGRKEREAWVTTKEYLAAVERRLKSNLKARL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaaggtaccaagatcaaggtcaagaacccagtcgttgaactggatggcgat
gagatgacccgtatcatctggcaggagattagagaaaaagtaagtccttcttaccttgac
attgacctcaagtattacgacttgggtattgaataccgtgaccagaccgatgacaaggtc
accgttgaggctgctgaggccattaagaagtatggtgttggagtcaagtgcgccaccatc
acccccgatgaagcccgtgtcgaggagttcaagctgaagaagatgtggctgtctcccaac
ggtaccatcagaaacattctcggtggaacggtcttccgtgaacccatcgtcattccccgt
attcctcgtctcgtccccggctggaacaagcccatcatcattggtcgtcacgccttcggt
gaccagtaccgtgctaccgacattgtcgtccctgggcccggtaagctcgagctcgtctac
acccctgagaacggtgagccccaggccatcaaggtctacgacttcaccggcggcggtgtt
gctcagacccagtacaacaccgatgattccatccgtggcttcgctcactccagcttcaag
atggccctgatgaagggtctgcccctgtacatgagcaccaagaacaccattctgaagaag
tacgatggccgcttcaaggatatcttccaggagatctacgagtctacctacaagaaggag
tttgacgccaagggcatctggtacgagcaccgtctcattgacgacatggttgctcagatg
atcaagagcgagggtgggttcgttatggctctgaagaactacgacggtgatgttcagtcc
gatgtcgtcgctcagggtttcggctcccttggcctaatgacctccaccctgaccacccct
gatggtagcgccttcgagtccgaggccgcccacggcactgtcactcgtcactaccgtgag
caccagaagggccgtgagacctccaccaaccccattgcctctatcttcgcctggacgcgt
ggtctggtccagcgtggcaagctggacgagacccccgacgtcgtcgccttcgccgaagag
ctcgagcgcgcctgcattgacgtcgtcaacgaggagggcatcatgaccaaggacctggct
ctggcctgtggccgcaaggagcgtgaggcctgggttaccaccaaggagtacttggctgct
gttgagcgcagactcaagtctaaccttaaggccagactgtaa

DBGET integrated database retrieval system