KEGG   Aspergillus fischeri: NFIA_069350Help
Entry
NFIA_069350       CDS       T01070                                 

Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00020  Citrate cycle (TCA cycle)
nfi00190  Oxidative phosphorylation
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
Module
nfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nfi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NFIA_069350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NFIA_069350
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NFIA_069350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 4590307
NCBI-ProteinID: XP_001263661
UniProt: A1D7S0
LinkDB All DBs
AA seq 647 aa AA seqDB search
MSSLSLRSLAPASKISRALRDQRRFFSSTRPAARIFANGPLRAKEATGYISSKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHPDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGLIYQRAFGGQSKEFG
KGGQAYRCCAVADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECRGIIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPAELLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDEQGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHRVRDIATPGKA
HRELSSDAGAESIKDLDFVRNADGPKSTHEIRNAMQKAMQSDVSVFRTQESLDEGVQKIT
AIDKMFDQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPER
DDENWMKHTLTWQKKPHGEIDLSYRAVEHKTLDENECKSVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctgagcttgcggagcctagctcccgcttcgaagatttcccgtgctttgagg
gaccagagacgttttttctcctcgacaaggccagcagcccgcatattcgccaacggtcct
ttgcgcgctaaggaggctactggttacatttcctcgaagtatcctgttatcgaccacgaa
tacgatgctgtcgttgtcggtgctggtggtgccggtttgcgtgccgccttcggtctggcg
gaagccggattcaacactgcctgtgtctcgaagctcttccctacaagatctcacactgtt
gccgctcaaggtggtatcaacgctgctctgggaaacatgcaccccgacgactggagatgg
cacatgtacgataccgtgaagggttccgattggcttggtgaccaggacgccatccactac
atgaccagagaggctcccgctagtgttcgtgagctcgagggctacggatgccccttctcc
cgtaccgaggatggccttatctaccagcgtgcgttcggtggtcagtccaaggaattcggc
aagggtggacaggcctaccgttgctgcgccgtcgctgatcgtaccggtcacgctcttctc
cacaccctctacggacagtctctgcgccacaacactaactacttcatcgagtacttcgct
ctggatctgttgatggaggatggtgagtgccgtggtatcatcgcctacaaccaggaggac
ggtaccctgcaccgcttcaaggcccaccacacagttttggccactggtggatacggacgt
gcctacttcagctgcacatctgcccacacttgcactggtgacggtatggccatggtcgcc
cgtgctggtttgcccaaccaggatcttgagttcgttcagttccacccaactggtatctat
ggtgctggttgcctgatcaccgagggtgctcgtggtgagggtggttatctgctcaactcc
gagggtgagcgtttcatggagcgttacgcccccaccgccaaagatctggcttctcgtgac
gtcgtctcccgttccatgaccctcgaaatccgcgagggccgtggtgttggtcccgagaag
gaccacatctacctgcagctgagccacctgcccgctgagcttctgcacgagcgtctgccc
ggtatctcggagactgcctctatcttcgctggtgttgacgtcaccaagcagcccatcccc
gtcctgcccaccgtccactacaacatgggtggtatccccaccaagtacaccggtgaggtc
ttgactgtggatgagcagggtaacgacaaggttgtccccggtctgtacgcctgtggtgag
gccgcctgtgtctccgtccacggtgccaaccgtctgggtgccaactctctcctcgacctc
gtcgtcttcggccgtgccgtttctcaccgtgtccgtgacatcgccacccctggcaaggct
caccgtgagctgagctccgacgctggtgccgagtccatcaaggacctcgactttgtccgc
aacgccgacggccccaagtcgactcacgagatccgtaacgccatgcagaaggccatgcag
tctgatgtcagcgtcttccgtacccaggagagtttggatgagggtgttcagaagatcacc
gccatcgacaagatgttcgaccaagtcggtaccaaggaccgcagcatgatctggaactcg
gaccttgtcgagactctggaacttcgtaacctgctcacttgcgctactcaaaccgctgtc
gccgccgccaaccgcaaggagtctcgtggcgcccacgcccgtgaggactaccccgagcgt
gatgatgagaactggatgaagcacactctcacctggcagaagaagcctcacggtgagatc
gacctcagctaccgtgctgtcgagcacaagaccctcgacgagaacgagtgcaagagcgtg
cctccctttaagcgtgtctactag

DBGET integrated database retrieval system