KEGG   Aspergillus fischeri: NFIA_074550Help
Entry
NFIA_074550       CDS       T01070                                 

Definition
(RefSeq) phosphatidylinositol 3- and 4-kinase, putative
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NFIA_074550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfi01001]
    NFIA_074550
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nfi03032]
    NFIA_074550
   03400 DNA repair and recombination proteins [BR:nfi03400]
    NFIA_074550
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NFIA_074550
Protein kinases [BR:nfi01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   NFIA_074550
DNA replication proteins [BR:nfi03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     NFIA_074550
DNA repair and recombination proteins [BR:nfi03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    NFIA_074550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC FAT
Motif
Other DBs
NCBI-GeneID: 4585861
NCBI-ProteinID: XP_001259432
UniProt: A1DDS8
LinkDB All DBs
AA seq 2823 aa AA seqDB search
MMAQVTLDKAIALLSSERLKERSDSLADLKHILQQNKRSSNLTSLNDKACHKIFESLFRF
ISVERSLYNKASSKGASASRLSACASVIRIAIDVFLRNLRTKSIRAIVDHITEILQVPGE
GLWEHLGADYLKCLTTLLRYPPHLEHLAAKEWDKVLNLCLRSIGAPEDGDSQSSDHNGHP
STLDDFLGASSRSTPSKRTSSLALREKQNGDKRIVAEAIVCIQLLTATPTAPVQSAAEKL
LRGLGIFLKLSPIAGSEHQAAFNSINTVVMRVIFDQSDLVRMFLLDLIAVIRHLWSTKLM
GLKDELLVTIMLCMIILTDATRREPTESLALSIENLLDTLYSEYTKRSEKDILQIDELIF
DRASSTQIIDLALQPRLEVPRSEHNLTVVWVMAKLMRLSEESTARLSHPAGEIPSKKQRL
NSASDEVYRDSVMSSGNRRVCALQLIPMLLQSHLSMESKASLLQRLIPYILDDNGVIASW
TMVAISSISDSSLELWAIITRLGAQTNPGSVSNASKQICSWLREAWVIGTVTDRMQTAQV
AAFARPLDLLNLFLACTNRQFEVPTPQFRGPSGLVAKGWHFYQSNRELLNYLFHVDGMLG
SASMHGGDDCISLQLATRKDPNDDIVLDLLQAKSEMFLQAWRSLSDSKSHHVTVDVVQIL
ASFCIVAILYTECILEQSHTQIKDLRGNIQQLWDSLCSFMASRELVFVQYCLELLCPFLS
QGRRVGFEKSVVNSTLYRLVSPLSEILENHRQDQKRLLSSDEEEPMDLDDQLLQSNDLLA
ENMCIINSNRESVPLFHDSATFQRSMTIRLSIFKIAYGSVVQPEQPASSALVEYLTDLDE
ADVLSARDFLPDVYRACAGYERTSLLDLLEDMGEKCLQTYQLERCETSQILCIHMMDSFV
KSWTTGAGDHLSDSASDIYNWVTDVLLAKGRASSRVLMAFSSLLDEIFSTNPVYTSGESN
PSPRTTLFMILQESDILTKYNVGNLVPKLFRHFPLKDHDAIFDDILESLPRDPDWTEGIA
LRLFILARLASQWHTLLRRSIYHMFETPAQLPHSRWHAEKCIRHVASVLGLEDARQLFRL
FSSQILYTWTENESVMTMPFTIFGYSTLEDMLSDVQDEIVGQIMMRANEHEASELSTRLE
TPFIELLATSFYKAEAYSIARDISTPPGQSSQPKGVENRLKKILGADRFVSLVEKQFPQV
IATFFGALDQCEQIERAFSKRANFQEAFSILKSITAKGASKEVLPPSQQPSFRARYLLDE
LEFLCKRSGYELETIWTPTLASYVCRTLLESIHPALGSLHACSVIRKIRILICITGPVML
RDYPFEMLLHALRPFLTDIHCSEDALGMFWYLLDAGRSYLTENPSFTAGIAVSTLLSFRK
FMASTTATVQESQSVAVLTIVQTFLQWFEDFLKFYESPHLSAEAHAFFQRLMESSRRISA
PGKESDGTECNLLLEVIQDRNSKTRLLSQSISDHILSLLCASFKSAPNYHQGLVERGYDA
IANSVALYQTLQDFSPTKEYRLWAARVIGRNFAATGMISDDLLREQQSTLFEPRMAKLNL
HMFCQSKARILQVLCSMLQNSSPLEVGLVERTLQLIVSNLAGSPGFENYEEIISPSLLKA
LVWSPYQCPSIPLPASQAKNHDTIVGWNPGISAAHWARSIGLFLTKAAPQDPVIGPLRNI
LHVIPSLAVRILPYILHDVLLTEPDGVGNVRQTISDIFRQGLHEADDHSIPHVRLIINCL
LYLRNQPRPQEATIVERDEWLEIDFAVASKAANTCRLPKTALLFLEIQASRAVSGTRRSS
LVKYEPPPDLLHDIFRNVDDPDLFYGVQQSSSLESVMETLEHESSGFKNLLFQSAQYDCE
IQMSGDADAHGLLKALNSTNLQGIANSLTSTLKGSKSSVSFDSMMQAAIDLRQWDLPVSP
LNHSPSAALFRTFQSLNTSRSLVDASNSVNENLLAILGSLGSTSRSAMSFRAAMRDLGIV
TEISDVLSAMSLEELNEEWRKIAERNSWLKATSVDEVGEILKCHEALFSSIKTRDYLKSA
VGLSDRDAQLLEVKVIRQSLSITRSHGIPQASLKSAVRLSKLANVCVVQGINVEGATKFD
LANVLWDQGEMAASIRMLQQLDNQGDLHKQAIPISRPELLVTLGHHVAEARLEKPEAIIQ
GYLAPAVKELKNRSEAEEAGRVYHGFAIFCDQQLQNPDGLEDFRRVEQLRNRKEKEVLGL
EEMMKNAEGKEREALRHYRTKTKQWFDLDDREYQRLRRSREAFLQQCLENYLLCLKESDI
YNNDALRFCALWLGKSDSEIANKAVSKYLNQVPSRKFAPLMNQLTSRLQDTSDEFQNMLF
ALIFRICVEHPFHGMYQIFASSKSKGGKDPSALSRNRAASRLVDYLKNDKRIGPTWVAVH
NANISYVRFAVDRLDEKVKSGAKVPLKKLLTGQRLEQDASTQKLPPPTMKIAIRVDCDYS
DVPKLVRYHPEFTVASGVSAPKIVTAVATDGQKYKQLFKGGNDDLRQDAIMEQVFEQVSS
LLKDHQATQQRKLGIRTYKVLPLTSNAGIIEFVPHTIPLHDYLMPAHQRYFPKDMKPNVC
RKHISDVQTRSFEQRVKTFRQITEHFHPVMRYFFMEKFNSPDDWFSKRLSYTRSTAAISI
LGHVLGLGDRHGHNILLDERTGEVVHIDLGVAFEQGRVLPVPEVVPFRLTRDLVDGMGIT
KTEGVFRRCCEFTLEALRQESYSIMTILDVLRYDPLYSWTLSPLRMKRMQDAQEAGDGPP
MISGAAEDQRSANEPSEADRALTVVAKKLSKTLSVTATVNELIQQATDERNLAVLYCGWA
AYA
NT seq 8472 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcaggtcactcttgacaaggccattgcgcttttgtcctccgagagactgaaa
gaacgatctgacagccttgcagatttgaaacatattctccagcagaataaacggagctca
aacttaacctcactcaatgataaagcttgccataaaatcttcgagtcccttttccgattc
atctccgtcgaaagatccttgtataacaaggcgagttccaagggagcatccgcctcgcgg
ctgtccgcttgtgcatccgtcattcgaatagctatcgatgtctttctgcgtaacctgaga
acaaagtcgatccgggctatagtcgaccacataacagagatcctacaagttcctggagag
ggtctgtgggagcatctcggtgcggattatctgaaatgcctcaccacactgttgcgctac
cctccccacctcgagcatttggccgccaaggaatgggacaaggttctgaacctctgtcta
agaagtatcggtgctccagaagatggggatagccaatcgagcgaccacaatggtcatccg
tctactttggatgactttctgggtgcaagctcacgctcaacaccatcaaaaagaacctcg
agtctggctttgcgggagaagcagaatggcgacaagagaatcgtcgcggaagcaatagta
tgtatccagctacttacagcgactccgactgcccccgtgcaatcagccgctgagaagctc
cttcgcgggcttgggatctttttgaagctttcgccgatcgctggaagtgaacatcaggcc
gcgttcaatagcataaatacagttgtcatgagagttatttttgaccagtcagatctcgtt
cgcatgttcctcttggatctaattgcagtaattcgacacctgtggtctaccaagcttatg
ggcctgaaggatgaactcctcgtcactattatgctttgcatgatcatcttgaccgatgca
actcgcagggaaccaacagagtccctagctctttcaatcgagaaccttttggacacactg
tactcggaatatacgaaacgttctgagaaggacattctgcagattgacgagttaattttc
gatcgagcgagctccacgcaaatcattgatctcgcactgcaacctcgacttgaagtgccc
aggtccgagcacaacttgaccgtcgtatgggtcatggcaaaattgatgcgattgtcagag
gaatcgaccgcgcggttatcgcatccagcaggcgaaataccaagcaagaagcaacgattg
aactcggcgtcggacgaagtttatcgagactctgttatgtcgtcgggcaacaggagggta
tgtgccctgcagttgatccccatgctcctccagagccacctcagtatggagtcgaaagcc
tcactacttcagcgattgatcccctacatactcgatgacaacggcgtcatagcttcgtgg
acaatggttgccatttcaagcatctcagattcatccttggagctgtgggcgatcataaca
aggttgggcgcacagacgaacccaggctcagtatcgaacgcctcgaaacagatctgctca
tggctacgagaagcttgggtgataggcacagtaaccgatcgaatgcaaacagcgcaggtc
gctgcttttgcacgccctctagatcttctcaatctatttcttgcttgtaccaatagacag
ttcgaggtgcccaccccacaatttcgaggaccgtctgggcttgttgcaaaaggctggcac
ttttaccaaagtaaccgagagcttctcaactacctcttccatgtggatgggatgctgggc
tccgcaagcatgcatggcggagatgattgcatatctctgcaactcgcgactcggaaagac
cctaacgacgatatagtactcgatctgttgcaagcgaaatccgaaatgttcttgcaagca
tggcgatcgttatctgacagtaaatcacaccatgtgactgtcgatgtcgttcagatactc
gcttcattctgcatagtcgctatattgtacacggaatgcatacttgaacaatcgcacact
cagataaaggacttgcggggcaatatccagcaactctgggacagcctttgttcatttatg
gcgtctcgtgagcttgtgtttgtgcaatattgcctggagcttctgtgtccctttctgtcc
caaggaaggagggttggcttcgagaaatcggttgttaatagcaccctgtacagacttgtt
tctcccttaagtgaaatcttggagaatcatcgacaagaccagaagcggttgctatcgtct
gatgaggaagagccaatggatttggacgaccagctactgcagtccaacgatctactggcg
gagaacatgtgtatcattaactcgaaccgagaatctgtccctttatttcatgattctgcc
actttccaacgctcaatgactatccggctctcaatcttcaagatagcatatggctctgtc
gtgcagccggaacagccagccagtagtgctctggttgagtacttgacggatttggatgaa
gctgatgtattgtctgcaagagacttcctgcccgatgtttatcgggcatgtgcaggatat
gaacgcacctccctattagatttgttggaggacatgggcgagaaatgtctgcaaacctac
caactggaacgttgcgaaacctctcagattctgtgcattcacatgatggatagtttcgtc
aaatcatggacgacaggagctggagatcatctcagtgactcggcttcagatatctacaat
tgggttaccgatgtcttattggcaaagggtagggcttcttcccgagtattgatggccttt
tccagtcttcttgatgaaatattcagtaccaaccccgtgtacacaagcggtgaatccaac
ccctcgcccagaacaactcttttcatgatccttcaggaaagtgatatcctaactaagtac
aacgtgggcaacctcgttcccaaattgtttagacacttcccactgaaagatcacgatgcg
atctttgatgatattttggaaagccttccccgcgatcctgactggactgagggtattgcg
ctccgtttgttcatattggcaaggttggcttcacagtggcacactttacttcggaggagc
atctatcatatgttcgagacaccggcccagcttcctcactctcggtggcacgctgaaaaa
tgcatacgacacgttgcaagtgtccttggactcgaagacgcacgacaattattccgcctc
ttctcctcccagattctctacacctggactgaaaatgaatcagttatgacaatgcccttc
actatatttggttattccacccttgaggatatgctgagcgatgtccaagatgagattgta
ggtcaaatcatgatgcgggccaatgagcacgaggcaagcgagctctcaacccgtctggaa
acgcctttcatagagctcctggcaacatctttctataaggcagaggcgtatagtattgcg
cgagacatcagcactcctcctggacagagttctcaaccgaaaggggttgaaaatcgattg
aagaagatcttgggcgctgaccgtttcgtgagtctggttgagaagcaatttccgcaagta
attgcaacgttctttggagccctagatcagtgtgagcagattgagagagcgttctccaag
agggccaattttcaagaagctttcagtattttgaaatcaatcactgctaagggcgcctca
aaggaagtacttccccccagtcagcaaccttcattcagggcgcgctaccttctagatgag
cttgaatttctctgtaaaagaagcggttatgagctcgaaacgatctggacacctacactg
gcatcttatgtctgccggacacttctggaatcaattcaccccgcgcttggctctcttcat
gcctgctctgtcattcgcaagatcaggattttgatctgtataaccggccctgttatgctg
agagattatcccttcgaaatgctcctacacgctcttcgaccgttcctcacagatatacat
tgctccgaggacgcactgggaatgttctggtatctcttggacgctgggaggtcttacttg
actgaaaatcctagtttcacggctggcatcgcagtgtccaccttgctctcttttcgaaag
ttcatggcctctacaacggccaccgtgcaggaaagccaatctgttgcagttctgacaatc
gttcagacctttcttcaatggttcgaagacttcttgaagttttacgagtcacctcaccta
agcgcagaggcgcatgccttctttcagcgtctgatggagtcttcgcgcaggatctctgcc
ccaggcaaagagtcggatggcacggagtgtaatttgcttctcgaagtgatacaggaccgc
aattctaaaacgaggttgctgagtcagtcaatatctgatcacatcctgtctttgctttgt
gcaagcttcaagagcgctcccaactaccatcagggccttgtcgaaagagggtatgacgct
attgcaaatagtgttgctttatatcagactctccaagacttcagccctacaaaagagtac
cggctgtgggctgcccgggtaattggacgcaattttgctgctactggcatgatcagtgat
gatctgttgagggaacagcagtcgaccctattcgaacctcgaatggctaagttaaacctc
cacatgttctgccagtcaaaagccaggatattacaggtgctttgcagtatgttgcagaat
agcagtcctctggaagtcgggcttgttgaacggaccttgcagctcattgtcagcaatctt
gccggttccccgggatttgaaaattatgaagagatcatatctccttcccttctgaaggca
ctggtttggagtccatatcagtgtccatcaatacccttgcccgcttctcaggccaagaat
cacgatactattgttggatggaaccctggtatctccgctgctcactgggctcgcagcatt
ggacttttcttgacaaaggctgctccccaagatcctgttattgggccgctgagaaacatt
cttcacgtcataccttcattggcagtccggattttgccatacattctgcatgacgttttg
ctcacggagcctgacggcgtgggcaatgttaggcaaaccatttctgatatcttcaggcaa
ggtctacacgaagctgatgaccattccatccctcatgtccgtctcatcatcaactgcctt
ctgtatcttcggaatcaaccgcgtcctcaagaagcaacgatagtagaacgtgatgagtgg
cttgaaattgattttgcagtggcatctaaggctgcaaacacatgccgcttacccaagaca
gcactgctgtttctcgagatccaggcctcgcgggccgtgtctggaactcgccgctcctct
ctcgtgaagtatgaacctcctcctgacctccttcatgacatttttagaaacgtggacgat
ccggatcttttttacggcgtccagcaaagctcgtcactagagtccgtgatggagaccttg
gaacatgagagctccgggttcaagaatctccttttccagagtgcccagtatgattgcgag
attcagatgtcgggagacgccgacgctcatggtctattaaaggcactcaactcaactaac
ctgcaaggaattgcaaactcattgacctcgactctcaaaggctcaaaaagctctgtctca
tttgatagcatgatgcaagctgcgatagatctgcgacaatgggatttaccagtttcgcct
ttgaatcactctccgtcagctgcactctttagaacctttcaaagcctgaacacttcgaga
tctctggttgatgcttcgaattccgtcaacgaaaaccttctggccatattgggctcacta
ggaagcacgagtcgctctgctatgtccttccgggcagcgatgagagacctgggaattgtg
accgagataagcgatgtcttgagcgcgatgtctctcgaagagttaaatgaagaatggcgg
aagatcgcagaacgaaactcttggttgaaagcaacaagtgttgatgaggttggagagatc
ttaaaatgccatgaggctttgttctcctctatcaagacaagggattatctcaaatccgcc
gtaggactaagcgaccgagatgcacagctactggaagtcaaggttattcgccagtcactt
tccatcacgagaagtcatggtataccacaggcttcattgaagtctgcagtgcgcttgtct
aagcttgcaaacgtgtgtgtggtgcagggaatcaatgttgaaggagcaacaaaattcgat
ttggccaacgtcctatgggaccaaggggagatggcagcgtcgattcgaatgcttcaacag
cttgacaatcaaggtgatctgcacaagcaggcaattccaatcagccgcccggagcttctt
gtgaccctcggccatcatgtggcggaagcacgcttggagaagccagaagctatcattcag
gggtaccttgcccctgcagtgaaggaacttaagaaccggtcggaagctgaagaggccggt
agagtatatcacggcttcgccatcttctgtgatcagcaactacagaatcccgacggactg
gaggactttagacgagtcgagcaactacgtaaccgcaaggaaaaggaagtactgggtctc
gaagagatgatgaagaatgcagagggcaaagaaagagaggctctgaggcactaccgaacc
aagacaaagcagtggtttgacctggacgatcgagaatatcaacgtctgcgacgcagtcga
gaggccttcttgcaacaatgccttgaaaactatttactttgcctcaaagaaagcgacatt
tataacaacgatgcgctccgcttctgtgccttatggcttggcaaatccgacagtgagatt
gcaaacaaagctgtctccaaatatctcaaccaggtcccgagtcgcaaattcgcgccactg
atgaaccaacttacttcccgtctccaagacacctctgacgagtttcagaatatgctcttt
gcattgattttccgcatttgcgtcgagcatcccttccatggcatgtaccaaattttcgcc
agcagcaagtccaagggtggaaaggacccgtcagctttgtctcgtaatcgagcggcaagc
aggctggtagattacctgaaaaatgacaaacggattggaccgacatgggttgcagtgcac
aacgcgaatatcagttacgtgcggttcgcggtcgatcgactggacgagaaggtcaagagt
ggtgcgaaggtgccattgaagaaactcctgacgggccagcgactagaacaagacgcttcg
acacaaaagctgccgccacctacgatgaaaattgccatccgtgttgattgcgactacagt
gatgttcctaagcttgttcgatatcatcctgaattcacggttgcatctggggtgagcgca
ccgaagattgtcaccgccgtagcaacggatggccaaaagtataagcaactattcaaagga
ggcaacgacgacctacggcaggacgcaatcatggaacaagtattcgagcaagtgagcagt
cttctcaaggaccatcaggcgacgcagcaacggaagctaggaattcgaacatacaaggtc
ctcccactgacttcgaatgcgggaatcattgagtttgtgccgcacaccatccctctgcat
gactacttgatgccggcgcatcagcgatatttccccaaggacatgaagcccaatgtgtgc
cgaaagcatatcagcgacgtacagacgcgctctttcgagcagcgagtcaaaacattccgc
cagattacggaacatttccatcctgtcatgcggtacttcttcatggagaagttcaacagc
ccggacgattggttcagcaagaggctttcatatactcggagcactgcggcgatttccatt
ctggggcatgtcctggggcttggtgatcggcatgggcataatattttgctggacgagaga
accggagaggtcgttcatatcgatttgggtgtggctttcgagcaaggccgagtcctaccg
gtccctgaggtggttcccttccgactgacgcgcgatctggtcgacggtatgggcatcacc
aagacagaaggtgtcttccggcgatgctgcgaattcaccctcgaggcacttcgacaggaa
tcgtacagtatcatgacgatcctggatgtgcttcggtatgatcctctgtacagctggact
ctctctccgctgcgcatgaagcggatgcaagatgctcaagaagccggtgatggtcccccc
atgatatcaggtgctgctgaagatcaacggtcagcgaatgaacctagtgaagcggatcgc
gctctgacggttgtggcaaagaaactgagcaagactctcagtgtcacagcgactgtcaat
gaactgattcagcaggcaactgatgaaaggaaccttgctgttctctattgcggctgggcc
gcatatgcatag

DBGET integrated database retrieval system