KEGG   Aspergillus fischeri: NFIA_079180Help
Entry
NFIA_079180       CDS       T01070                                 

Definition
(RefSeq) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00220  Arginine biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01210  2-Oxocarboxylic acid metabolism
nfi01230  Biosynthesis of amino acids
Module
nfi_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NFIA_079180
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     NFIA_079180
    2.3.1.35  glutamate N-acetyltransferase
     NFIA_079180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-GeneID: 4586430
NCBI-ProteinID: XP_001259874
UniProt: A1DF20
LinkDB All DBs
AA seq 456 aa AA seqDB search
MAAFARMVKGQVRNYSAPLDMAIPASKQKYIPSSGSYPKGFLVSGTHVGVKASNTKFPDL
ALISSETPCSAAAVFTTNKFQAAPVQVSKKTLESRQGQGIRSVVINSGCANAVTGKGGLE
DAVSMGKKVDECNGLSEPSTIVMSTGVIGQRLPISKILNKIPTAHENLASTHDAWLTTAR
AICTTDTFPKLLSRTFVLPSSPGRTYSLAGMTKGAGMIHPNMATLLGVLCTDAPIDPSAL
QSLLTHAVSRSFNSISVDGDTSTNDTVAILANGAAGGAPISSPASDDYTAMQDILTSFAQ
SLSQLVVRDGEGATKFVTVRVQNSPDYESARLIASTIARSPLVKTALYGRDANWGRILCA
IGYTQGVAPGTVVPERTSVSFKPVDGSPVLKLLVNGEPEQVDEERASVILQEEDLEIVVD
LGGGEKGEQGLGGEEAVYWFCDFSHEYVTINGDYRT
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttcgccagaatggtgaagggccaagtgcgcaactactctgctcctctggac
atggccattcccgcctccaagcagaagtacatcccgtcctctggatcctatccaaaggga
ttcctcgtctccggtacccacgttggtgtcaaagcctccaacaccaagttcccggacctg
gcattgatctcctccgaaaccccatgctcggctgctgcggttttcaccaccaacaagttc
caagcggcacctgttcaagtcagcaagaagacccttgagagccgccagggacaaggcatt
cgatcggtggttatcaactctggctgcgccaatgcagtcaccggtaagggaggtctggag
gatgcagtgagcatgggcaagaaggtggacgagtgcaacggactcagcgagcccagcaca
atcgtcatgagcactggcgttattggacaacgacttcctatctccaagatccttaacaaa
atccccacggcacacgagaacctcgcatccacgcacgacgcctggctcaccaccgcccgc
gccatctgtacaacagacaccttccccaagctgctctcgcgaaccttcgtcctcccttcg
tcccccggccgcacctacagcctcgccggcatgaccaaaggcgccggcatgatccacccg
aacatggccaccctcctcggcgtactctgcaccgacgcccccatcgacccttctgccctg
cagtccctcctcacgcacgccgtctcgcgctccttcaactccatctccgtcgacggcgac
acaagcacaaacgacacggtcgccatcctcgccaacggcgccgccggcggcgcccccatc
agctcccccgcctcggacgactacaccgccatgcaggacatcctcacctcgttcgcgcag
tcgctctcgcagctcgtcgtccgcgacggcgaaggcgccaccaagttcgtcaccgtccgc
gtccagaactccccggactacgaatccgcccgtctcatcgcgtccaccatcgcccggtcc
ccgctcgtcaagaccgccctctacggccgcgacgcaaactggggccgtatcctctgcgcg
atcgggtacacgcagggcgtggctccgggaacggtcgtccctgagcgtacaagcgtcagc
ttcaagcctgtggatgggagtcccgtgctcaagctgcttgttaacggtgagccggaacaa
gtcgatgaggagcgcgccagtgtcattcttcaggaggaggatctggagatcgtcgttgac
ttgggtggtggtgagaagggtgagcagggcctgggtggtgaagaggctgtctactggttc
tgcgactttagccacgagtacgtgactatcaatggtgattataggacttga

DBGET integrated database retrieval system