KEGG   Aspergillus fischeri: NFIA_082630Help
Entry
NFIA_082630       CDS       T01070                                 

Definition
(RefSeq) hexokinase Kxk, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00010  Glycolysis / Gluconeogenesis
nfi00051  Fructose and mannose metabolism
nfi00052  Galactose metabolism
nfi00500  Starch and sucrose metabolism
nfi00520  Amino sugar and nucleotide sugar metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
Module
nfi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nfi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_082630
   00051 Fructose and mannose metabolism
    NFIA_082630
   00052 Galactose metabolism
    NFIA_082630
   00500 Starch and sucrose metabolism
    NFIA_082630
   00520 Amino sugar and nucleotide sugar metabolism
    NFIA_082630
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NFIA_082630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nfi04131]
    NFIA_082630
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NFIA_082630
Membrane trafficking [BR:nfi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NFIA_082630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4586769
NCBI-ProteinID: XP_001260212
UniProt: A1DG08
LinkDB All DBs
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKDFEEMFTVDRAKLKQVVDHFVKELEKGLSVEG
GNIPMNVTWVMDFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGGFDICQSKYRMPEELK
SGTAEELWEYIADCIQQFIEFHHGEEGLTSLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGQDVVPPLEETLKRKGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAY
MEDVGSVPKLAHMNLPPDMPVAINCEYGAFDNEHVVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALIDLLDSRPGLIFQNQDTSKLRKPYLLDASFLAAIEEDPYENLQET
QELFERELNIKPTLAELEMIRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPNEKDKVTIMAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNKDEMQKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcggaattggtcccaagcgccccccatcccgcaagggatcgatggccgatgtgcct
cagaatcttctacagcagattaaggatttcgaggagatgtttactgtggacagagccaag
ctcaaacaggtggttgaccacttcgtcaaggagctcgagaagggtctcagtgtggagggt
ggtaacatcccgatgaacgttacctgggttatggacttccccgatggagacgagcaggga
accttccttgccttggatatgggtggcaccaacctccgcgtctgtgagattaccttgaca
gaagagaagggaggcttcgatatctgccagtccaagtaccgcatgccggaagaactgaag
tccggaaccgctgaggagctgtgggaatacatcgccgactgcatacagcaattcattgag
ttccaccacggagaggaaggattgacatcattgcccctgggtttcaccttctcctacccg
gctacacaagagtacattgatcatggtgttcttcagcgctggactaagggcttcgacatt
gatggtgtcgagggacaggatgtcgtccctcccctggaggaaacactgaagagaaaggga
cttcctatcaaggtcgctgctttgatcaacgataccactggaacgctcatcgcctcggcc
tacactgatcccgagatgaagattggatgtatttttggtacaggtgtcaatgcggcctac
atggaggatgttggctccgtccctaagctggcccacatgaacttgcccccagacatgcca
gtggccatcaattgcgagtacggtgctttcgacaacgagcacgttgttcttcccctcaca
aagtacgatcacatcattgaccgcgactctccccgcccgggtcagcaggccttcgagaag
atgacagccggtctctacctgggagagatcttccgtctggccctgattgatctcctggac
agcagaccaggactgattttccagaatcaggacaccagcaagctgcgcaagccgtacttg
ctggacgcttccttcctggctgccatcgaggaggacccctacgagaacttgcaggaaaca
caggagctgttcgagcgcgaattgaacatcaagcccactctggccgagctcgagatgatt
cgtcgtctggccgagctgatcggtacgcgtgcagctcgtctgtcagcttgcggtgtggcg
gctatctgcaaaaagaagaacatcgagagctgccacgttggtgcggacggctccgtcttc
accaagtaccctcacttcaaggctcgtggtgcccaggctctgcgagagatcctggactgg
gccccgaacgagaaggacaaggtcaccattatggcggccgaggatggttccggtgtcggt
gccgcgctgatcgccgccttgactctcaagcgtgtcaaggccggcaacctggctggtatc
cggaacaaagacgaaatgcagaaactgctttaa

DBGET integrated database retrieval system