KEGG   Aspergillus fischeri: NFIA_086850Help
Entry
NFIA_086850       CDS       T01070                                 

Definition
(RefSeq) alpha-glucosidase/alpha-amylase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00052  Galactose metabolism
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NFIA_086850
   00500 Starch and sucrose metabolism
    NFIA_086850
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NFIA_086850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 4587185
NCBI-ProteinID: XP_001260627
UniProt: A1DH73
LinkDB All DBs
AA seq 602 aa AA seqDB search
MPCPTTRNKCVTASGTFKPQILDMDREWWREIIIYEIYVQSFQDSNNDGIGDLRGIIQRL
DYLKDLGADMLWLTPIYESPLEDQGYDIANYKGINPMYGTMKDWEDLAAEIHRRGMKIMM
DMVFNHTSSQHAWFLESKESRENPKRDWYFWRRGKIGKNGERLPPNNWESLFGGPAWKYD
EHTDEWYMHLFSPSQPDLNWDNPEVRNAIFDVIDFWGQKGTDGFRFDVINLVSKTPGLPD
APIVNPDKYEQPAVPLFTNGPNIHKYMHEMNRNVLSKYTNCTVGEMPCGVDEYESSQYVA
KERQELSMVFQFHHMDLDGENGDKWKPRKWELWEFEKVFRIWQQHMLGNNGWNSLYLENH
DQSRCVSRFGNPDPRYRAVSAKMLATIQLSLRGTPFIYQGQELGTPHPQNWKIEDYNDVE
THGYYNAQYKARKEKDPSKEPDMSDVMDVIRLKGRDNARSPIMWNNAPNAGFTSPDAKPW
LRMNDEYADVNVQAQNRDPDSVLNYYKKLLHIRKQHPLMWYGVYIPINASDPKVFSFLRT
QGPWRTLIFCNWSAEESDFEIPEEIDVDLAIMLIANYHVDEYQLQQKVRLRPYEARIYSL
RN
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccatgtccaacgactcggaacaagtgcgtgacggcgtccggcacgttcaagccgcaa
attctcgatatggatcgagaatggtggcgagagatcatcatctatgagatctacgtgcag
tcgttccaggatagcaacaatgatggtattggtgatcttcgcggcatcatccagcggctc
gactatctgaaagatcttggggcggatatgctgtggctgacgccaatctatgaatcacca
cttgaagatcaaggctacgacattgcaaattacaagggtatcaatcccatgtatgggacc
atgaaagactgggaagaccttgctgcagaaattcataggagaggaatgaagataatgatg
gacatggtgttcaaccacaccagctctcagcatgcatggttcttggagtcgaaggaaagc
cgagaaaacccgaagagagactggtacttctggcgaaggggaaagataggcaaaaatgga
gagcgcttacctcctaacaattgggaaagtctgtttggaggtccggcatggaagtatgat
gagcatacagacgagtggtacatgcatctgttctcgccatcccagccagacctgaactgg
gacaaccctgaggtgcggaatgcaattttcgacgttattgatttctggggacaaaaagga
acagacggcttccggtttgatgttataaaccttgtctccaagacacctggtcttccggat
gcacccattgtgaaccctgataagtacgagcaacctgccgtgccattattcacgaacggc
cctaatatccacaaatatatgcatgagatgaatcgcaacgtgctgagcaaatacaccaat
tgcacagttggtgaaatgccgtgtggtgtggacgaatacgagtccagtcagtatgtggcc
aaggagcgccaggagctctctatggttttccagtttcaccatatggatctggatggtgaa
aatggagacaaatggaagcctcgcaagtgggaactctgggaatttgagaaggtgttcagg
atttggcagcagcatatgctgggcaacaacggttggaattctctgtatcttgagaatcat
gaccaatcccggtgtgtgtcacgatttggcaaccctgatccgcgatacagagccgtgtca
gccaagatgttggctacaatccagctctctctgagaggaaccccttttatctaccagggc
caggaattgggtaccccacatccgcagaactggaagattgaagattataacgatgttgag
acccatggatactacaacgctcagtacaaagctcgcaaggaaaaagatccctccaaggag
cctgacatgtccgatgtgatggatgtcattcgcctcaaaggacgggacaatgcgcgtagc
cctattatgtggaataatgcgcccaatgcaggcttcacttcaccagatgccaaaccttgg
ctccgaatgaacgatgaatatgccgatgtcaacgtccaggctcagaatcgtgatcccgac
tcggtcctgaactactacaagaagctgttgcatatccgcaaacaacatccgctgatgtgg
tacggagtctatattcctatcaatgcgagtgaccccaaggtcttctctttcctgcggact
caagggccgtggcgcaccttgatcttctgcaactggtcggcggaagagtccgattttgag
attcccgaagagattgacgttgacttggctatcatgctcatcgccaactaccatgtggat
gaatatcagctgcagcagaaggtccgactcaggccatatgaggcccgcatctactccctt
cgtaactaa

DBGET integrated database retrieval system