KEGG   Aspergillus fischeri: NFIA_091190Help
Entry
NFIA_091190       CDS       T01070                                 

Definition
(RefSeq) alcohol dehydrogenase, zinc-containing
Organism
nfi  Aspergillus fischeri
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 ADH_N_assoc Pyr_redox 2-Hacid_dh_C Shikimate_DH ADH_zinc_N_2 Pyr_redox_2 NAD_binding_7 Pyr_redox_3 Hydrolase_6 adh_short
Motif
Other DBs
NCBI-GeneID: 4587615
NCBI-ProteinID: XP_001261057
UniProt: A1DIF3
LinkDB All DBs
AA seq 353 aa AA seqDB search
MRAVRFHGRGDVRVDEIDEPVCGEGQVKIRPAFVGICGSDLHEYLAGPITVPSTPHPITG
GSVPVTLGHEFSGVVEEVGAGVSRLKVGDCVAVRPNLYDGTCASCLAGWRNCCQNLGFIG
YSSDAGGLSDHVVVGEKHAILLPEGFPLDLGALVEPLTVAWHAASRASVRPDDTVLVVGG
GPIGLAVVQVLKARGVKSIIVSEVSSQRKQFARQLGATEVFDPRTDDIVASVRAMTAGVG
AAIAFECSGVQVGLDTAVQAIRARGTVTIVSLWEEKPKIDALDMVLREKHVIGAVICDDG
DFEAVIDAISSGKLSPRAMITSKILMEDVVAKGFKALIDERDKHVKILVEVST
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgtccgattccatggccgcggcgatgtccgtgttgacgagattgatgagccc
gtctgcggggaggggcaggtcaagatccgacctgcatttgtagggatctgtggaagtgac
ctacacgagtacctcgcaggtcccatcacagttccctcaacaccgcatccaatcacgggc
gggagcgtccccgtcaccctgggtcatgagttcagtggtgtggtagaggaggtcggcgcg
ggcgtttcacgactgaaagtcggtgattgcgtggctgtcagaccgaatctgtatgatggg
acgtgtgcgagttgtctagccggttggcggaactgttgtcagaatttgggatttattggg
tatagcagcgatgcaggaggtttgtcagatcatgttgttgtaggtgagaagcatgcgatt
ctgttaccggagggtttcccacttgatcttggggccctcgtcgaaccccttactgtggcc
tggcatgcagctagccgtgcctccgtccggcccgacgacactgtcctcgtggtaggggga
ggacccatcggtctcgctgtcgttcaggtcctgaaagcccgcggagtcaagtccatcata
gtctccgaagtatcctcacagcgtaagcagtttgcgagacaactaggtgcgactgaggtc
tttgatccgcggacggatgatattgtggcttcagttcgcgcaatgacggcaggagtggga
gcagccatcgcatttgaatgctccggcgtgcaagtgggcttggacacggctgtgcaggct
attcgagccaggggaacggtgaccatagtatcgctgtgggaggagaagccgaagatcgat
gcgctcgatatggttttacgcgagaaacatgtcattggcgctgtgatttgtgacgatggt
gattttgaagctgtcattgatgcgatttcatcaggaaagctctcccctcgagcgatgatc
acgagcaagatcctgatggaggacgtggtggccaagggattcaaggctttgattgacgag
cgggacaagcatgtcaagatcctagttgaggtgtctacatga

DBGET integrated database retrieval system