KEGG   Aspergillus fischeri: NFIA_093740
Entry
NFIA_093740       CDS       T01070                                 

Definition
(RefSeq) phytanoyl-CoA dioxygenase, putative
  KO
K17825  verruculogen synthase [EC:1.14.11.38]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00404  Staurosporine biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00786  Fumitremorgin alkaloid biosynthesis, tryptophan + proline => fumitremorgin C/A
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    NFIA_093740
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.38  verruculogen synthase
     NFIA_093740
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-GeneID: 4588684
NCBI-ProteinID: XP_001261651
UniProt: A1DA64
LinkDB
AA seq 291 aa
MTVDSKPQLQRLAADVDVDLMCRLLEEDGAFILKDLLPLDVVESFNRELDVQMAIPPPKG
ERLLADKYPPHFKYVPNVATTCPTFRNNILINPVIHAICEGYFQRTGDYWLSAAFLREIE
SGMPAQPFHRDDATHPLMHHQPLEAPPISLSVIFPLTEFTEENGATEVILGSHRWMEVGT
PERDQAVLATMDPGDVLVVRQRVVHAGGGNRTTTGDPRRVVLAYFNSCQLTPFETYRTMP
RETVESMTVLGQRMLGWRTMKPSDPNIVGINIIDDKRLENVLQLKATDLPA
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaccgtcgactccaagccgcaactccagcgcctcgccgccgatgtcgacgttgacctg
atgtgcaggctcctcgaagaggacggtgccttcatcctgaaggacctgcttcccctcgac
gtcgtcgagagcttcaatcgcgagttggacgtgcaaatggccatcccgcctcccaaggga
gagcggctgcttgcggacaaatacccccctcacttcaaatacgtcccgaacgtcgccacc
acttgcccgacgttccgcaacaacatcctcattaacccggtcatccacgccatctgtgag
ggctacttccagcgcacgggcgattactggctcagcgcggccttcctccgcgaaattgaa
tcgggaatgcccgcccagccgttccaccgcgacgatgccacccacccgctgatgcaccac
caacccttggaagcaccgccgatctccctcagcgtcatctttcccctgacagagttcacg
gaggagaacggcgccacggaggtcattctcgggagtcatcggtggatggaggtcgggacg
ccggagcgcgatcaggcggttctggcgactatggacccgggcgatgttctcgttgtgcga
cagcgtgtggttcatgcgggaggtgggaatcgcacgaccaccggcgatcctcgacgggtt
gttctcgcgtacttcaatagctgccagcttaccccgttcgagacctaccgcacgatgccg
cgcgagacggtggagtcgatgactgttctcggccagaggatgctcggctggaggactatg
aaaccgtccgatcccaatattgtgggtattaacattattgatgataagcggctggagaat
gtgctgcagttgaaggctactgatttgcctgcttag

DBGET integrated database retrieval system