KEGG   Aspergillus fischeri: NFIA_104450Help
Entry
NFIA_104450       CDS       T01070                                 

Definition
(RefSeq) glutathione transferase, putative
Organism
nfi  Aspergillus fischeri
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 4593823
NCBI-ProteinID: XP_001266854
UniProt: A1CWF5
LinkDB All DBs
AA seq 709 aa AA seqDB search
MDGPDLQRFRVDSHTSDGQPRSLSSLADDASALAATQQQHHQSHTQELADSQDAQSLQPL
QSALEHSELHLHHPQKQRHHQNAGHPLNTPASMQPSRPGESVNTELISPQQFNEKLHTYH
QTSREHTFPGSLSDGQQMQSCLSHSGDQEAHHEQVLSQVRSDLAHTAVECNGNGADSPSF
PHHLQLQPQGDGYSVAPALSRQDGCLKDMKLVPDPPDLEYWREKLFNVDETITLTEDQFR
TYFPHVDNVYSHRSTQRYKRKPFVSHYWDCRLKGRPPGTPKSDDPNKKKRKRTARQRDLC
DVKIKITEYFPGYGVAAVSDFAATGPETSFPPSEFLPSVNSLFHESSALGQRRDSQPFGV
LTPNPTLPEGHPGANGERFFTIQRVNGNGANGKNDGVGGGHRHTLEESDRVKKNSVQRYL
LKEAKERKKAVSVSVRSVLSRLILIQNILKLTRFLKTRMMPSQSEAQQKTYHTKATGLAA
LTAINHSNEAELKLFGSCFCPFVQRVWIALEIKGIPYQYIEVDPYQKPQSLLEVNPRGLV
PALRHGDWGSYESSVLLEYLEDLDGGPHLLPPGDAKLRAHCRLWTDHINRHIVPSFYRAL
QEQEEQRQTANMQELQDGLKTLITAANPEGPFFLGPTISFVDVQIAPWILRLSRVLKPYR
GWPDPEPGSRWAAWVNAIEANEHVKATTSSDELYLDSYERYARGYTFMP
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggacggtccggatctccagcgattccgcgtcgactctcacacttctgatggacagccc
cgatcgctgtcgtccctggcagacgacgcgtccgcattagctgcaacccaacaacagcat
caccagtcacatacacaagagcttgcagattcccaggacgcgcagtcgcttcagcctcta
caatctgcgctcgaacactcggagctccatctccatcatccgcagaagcagcggcaccat
caaaatgcgggtcatccgctcaatacaccggcgtcgatgcagccgtcacggcctggcgag
tcggttaacaccgagttaatatctcctcagcagtttaacgagaagctgcacacctaccac
caaacatcccgagagcacacattcccgggtagcctttcggatggccagcagatgcaatcc
tgtttatctcacagcggcgatcaagaagcacaccacgagcaggtcctgtcgcaagtacgt
tcagatcttgcacataccgctgtcgagtgtaatggtaatggggccgactcgccgtccttt
ccgcatcatttgcagctacagccgcaaggcgatggctactccgtggccccggcactctcg
agacaggatggctgtctgaaagacatgaaactggtccctgatcctccggaccttgaatac
tggagggaaaagctattcaacgtggacgagacgatcaccttgactgaagaccaattccga
acttacttcccgcacgtcgacaacgtctactcccaccgctccacacaacgctacaagcgc
aaacccttcgtctcccattactgggactgcagactcaaaggccgcccgcccggaaccccc
aaatcagacgacccgaacaagaagaagcggaaacgcaccgcccgacaacgagacctctgc
gacgtcaagattaaaatcaccgaatacttccccgggtacggcgtggctgctgtatcggac
tttgctgccacggggcccgagacctcctttcctccctcggagtttctgccgagcgtgaac
tcgttgttccatgaatcgtcggccttgggacagaggagggacagccagccgttcggcgtg
ctcacgccgaatccgaccttacctgagggtcatcccggggcgaatggggagagattcttt
acgatccagcgggtcaatggcaatggtgcgaatgggaagaatgatggggtgggtggaggc
catcggcatacattggaagagagcgaccgggtcaagaaaaatagtgttcagcgctatttg
ctgaaagaggccaaggagaggaagaaggcagtctcagtaagtgtgcgatctgttctttca
agactcattctgatacaaaatattttgaaactaaccagatttcttaagactagaatgatg
ccctcccaaagtgaagcccagcaaaaaacataccacaccaaagctactggcttagcggcc
ttgaccgctataaatcattccaatgaagcagaactcaaactgttcggaagttgcttctgc
ccttttgtacaacgcgtttggatagccttggaaatcaagggtatcccataccaatatatc
gaagtagatccataccaaaaacctcaatctctgttggaggtgaacccaagaggcctggtg
ccagcgttgcggcacggcgattggggatcgtatgaaagttcggttctgctcgaatatctc
gaagatttggatggtggtccgcaccttctgccgcctggcgatgcgaagttgcgagctcac
tgtcggctctggaccgaccatatcaatcgtcacatcgtgcccagcttctatagggctctc
caggaacaggaggaacaaaggcagacggcgaatatgcaggagctccaagacggtctcaag
acgctaatcacggctgccaatcccgaaggtccatttttcctgggaccgaccatctctttt
gtggacgtccagatcgccccttggatcctccggctgagccgggtgctcaaaccgtaccgt
ggctggccagaccccgagcctggaagccggtgggccgcatgggttaatgcgattgaggcc
aatgagcatgtcaaggcgacaactagctctgacgagttgtaccttgacagctatgagcga
tatgcccgtgggtataccttcatgccgtga

DBGET integrated database retrieval system