KEGG   Aspergillus fischeri: NFIA_105900Help
Entry
NFIA_105900       CDS       T01070                                 

Definition
(RefSeq) alpha-glucosidase AgdA, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00052  Galactose metabolism
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NFIA_105900
   00500 Starch and sucrose metabolism
    NFIA_105900
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     NFIA_105900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Rotavirus_VP7 DUF5110
Motif
Other DBs
NCBI-GeneID: 4593919
NCBI-ProteinID: XP_001266999
UniProt: A1CWV0
LinkDB All DBs
AA seq 988 aa AA seqDB search
MASLLGLVASAWLLPTAYGASHSLAPSTSATSAHAQYTLPSSIDVGAQLVANIDDPLAVD
AQSVCPGYKASNVHQTSQGFTASLQLAGDPCNVYGTDVDSLSLTVDYLAKDRLNIQIVPT
YVDASNASWYLLSEDLVPRAQGSGVSASQSDFDVKWSNEPSFNLKVIRKATGDVLFDTEG
SVLVFENQFIEFVSSLPEGYNLYGLGERMAQLRLLRNATLTTYAADVGDPIDSNIYGQHP
FYLDTRYYTKGTNGSYSLVNTDEADLSEDYESFSHGVFLRNSHGQEVLLQPRNITWRTIG
GSIDLTFYSGPTQADVTKSYQLSTIGLPAMQQYSTLGFHQCRWGYQNWSQLEEVVNNFER
FEIPLEYIWSDIDYMLGYRDFENDPERFSYDEGEEFLNKLHKSGRHYVPIVDSAIYIPNP
DNASDAYEPYARGAKDDVFIKNPDGTLYIGAVWPGFTVFPDWLNPKAFDYWANELVIWSK
KVAFDGIWIDMSEVSSFCVGSCGTGKLHLNPVHPPFQLPGEPGNIGYDYPEAFNVTNSTE
AASASAASASQASAAAATQTATTSTSTSYLRTTPTPGVRDVNYPPYVINHVQEGHDLAVH
AISPNSTHADGVQEYDVHSLWGHQILNATYYGLRQVFTEKRPFIIGRSTFAGSGKWAGHW
GGDNNSKWGSMFLSISQGLSFSLFGIPMFGVDTCGFNGNTDEELCSRWMQLSAFFPFYRN
HNVLGAIPQEPYRWASVTQASKAAMKIRYSILPYFYTLFHQAHTTGSTVMRALAWEFPTD
PSLAAVDTQFMVGPSIMVVPVLEPLADTVKGAFPGVGKGEVWYDWYTQTAVDAKPGVNTT
IPAPLGHIPVYVRGGSILPMQEPALTTRDARNTPWSLLVALSGNQTASGSLYLDDGTSLN
PSRTLDVDFQATAWSIKVSVKGTWEEKNRLDKVTVLGVGEKPSAVTFNGRNVHPGSVHYN
ATSKVLSVQGLHSMTPHGAWAGNWVLKW
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctcctgggcctcgtcgccagtgcttggctcctccccacggcctatggtgca
agccattcgcttgcgcctagcacgtccgcaacctcagcacacgcgcaatacactttacca
tcttctattgacgttggtgctcaattggtcgccaacatcgacgatccccttgccgtcgac
gcacagtctgtgtgtccgggctacaaagcctcaaatgtgcaccagacatcccaaggtttc
accgccagcctacagctcgcgggcgacccatgcaacgtgtacgggacagacgttgattcg
ctgtctctgacagtggattatctggccaaggaccgcctgaacatccaaattgttcctacc
tacgtggatgcctccaacgcttcttggtacctcctctcggaagacttggtgccccgggct
caaggctctggcgtgtccgcctctcaaagcgactttgatgtgaagtggtccaatgagcct
tctttcaacctcaaggtcattcgcaaggctactggagacgtcctcttcgataccgagggc
tccgtcctggtctttgagaaccagtttatcgagtttgtctcttcgttgcccgagggttac
aacctgtacggtttgggagagcgcatggcccagctgcggctcttgagaaacgcgaccctg
accacctatgcagcggatgtgggagacccgattgatagcaacatctatggacagcatccg
ttctatctcgacactagatactatactaaaggcacgaatgggtcttactcgcttgtcaac
acggacgaggcggacttgtcggaggattatgaatcattctcccacggtgtctttctgaga
aactctcatggtcaggaggttcttctgcaaccccgcaacatcacctggcgcacaattggt
ggtagcatcgatttgactttctactccggtcccacgcaagcggacgtcacaaagagctac
cagctctccaccattggacttcctgcaatgcagcagtacagcacccttggattccaccaa
tgccgctggggctaccagaattggtctcagctcgaggaagtggtcaacaactttgagcga
tttgagattcccctggaatacatctggagcgacatcgattacatgcttggctaccgtgac
tttgagaatgatcccgaacggttctcctacgatgaaggcgaggaatttctgaacaaactt
cacaagtcgggacgacactacgttcctatcgttgactcggcaatctatattcccaacccc
gacaatgcatcggatgcgtacgagccttatgctcgcggggcaaaggatgacgttttcatc
aagaaccctgatggcaccctctacatcggtgcagtgtggccgggctttactgtcttccca
gattggctcaaccccaaggcatttgactactgggccaacgaactcgtcatctggtcaaag
aaggttgcgttcgatggcatctggattgatatgagcgaagtatcctctttctgcgttggc
agctgtggaacaggaaagctacatctgaacccggttcacccaccattccagcttcccggt
gaacctggaaatatcggctacgactaccccgaggccttcaacgtgacgaactctaccgaa
gcggcctctgcctccgccgcctctgccagtcaggcttcggctgctgctgctacccaaacc
gccactacgtcaacatctacatcgtatctgcggacgacgcccacgccgggcgtccgtgac
gtcaactaccctccatatgtgattaatcatgttcaggagggtcatgaccttgccgttcac
gccatttctcccaactctactcatgcggacggcgtccaggaatacgatgttcacagtctg
tggggccaccagatcctcaatgccacctactacggactgcgccaggtcttcactgagaag
cgacccttcatcattggtcggtctacctttgctggctcgggcaagtgggccggtcactgg
ggcggtgataacaactccaaatgggggtccatgttcctgtccatctcgcagggtctgtcg
ttctcgctgttcggtattcccatgttcggcgtggatacctgcggtttcaacggtaacacc
gacgaggagctctgcagccggtggatgcagctgtcggccttcttccccttctaccgcaac
cacaatgtccttggggctatcccccaggagccctaccgttgggcctctgtcacccaagcc
tccaaggctgccatgaagatccgctattccatcctaccttacttctacactcttttccac
caggcccacaccactggctctaccgtcatgcgcgctctcgcctgggagttccccacggac
ccgtccctcgccgccgtcgacacccagttcatggtcggtccttccatcatggtcgtcccc
gtgctcgagcccctcgccgataccgtcaagggcgcgttcccaggcgtcggcaaaggcgaa
gtctggtacgactggtacacccagaccgccgtagacgccaaacccggcgtcaacaccacc
attcccgctccgctgggccacattcccgtctatgtccgtggaggcagcatcctgcccatg
caggaacccgccctcacgaccagagacgcccgtaacactccctggtcgctactcgtcgct
ctgagcggcaaccagactgcctcgggctcgctgtatctcgacgacggaaccagcctcaac
ccgtcccgcactctcgatgtcgacttccaggctaccgcctggagcatcaaggtctcggtc
aagggtacctgggaggagaagaaccgcctggataaggtgactgtcctcggcgtgggtgag
aagccttccgctgtgacgttcaacggccgcaacgtccaccctggctcggtgcactacaat
gctacctccaaggtgctgtctgtgcagggattgcacagcatgacgccccatggcgcctgg
gctggaaactgggttctgaaatggtag

DBGET integrated database retrieval system