KEGG   Aspergillus fischeri: NFIA_105910Help
Entry
NFIA_105910       CDS       T01070                                 

Definition
(RefSeq) Glycosyl hydrolase, family 15, putative
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_105910
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NFIA_105910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 4593920
NCBI-ProteinID: XP_001267000
UniProt: A1CWV1
LinkDB All DBs
AA seq 637 aa AA seqDB search
MNDETPRLAEMTRRQFLTIAIGVLTTVSALSDPAQIVIPATITPQTTDPLVSWLAQETSY
ALDGVFNNIGPNGAKATGASSGIVIASPSQSNPDYYYTWTRDAALTIKHLVGSFAADHDP
ALQRIIEDYIDSQAHLQTVSNPSGNLSSGGLGEPKLRVDGSAFRGSWGRPQSDGPALRAT
TLISYANLMIDNGYFSTVESSVWPIIQNDLSYLTEFWNSSTFDLWEEVRGSSFFTTAVQH
QALSQGAALTQSLGKTCSNCQSQAPQVLCFLQTYWTGSSILANLYSDRSGKDASSILGII
HTFDPNAGCDGETFQPCSERALASHKEVVDSFRSLYPINADIPQGQAVAVGRYPEDVYQG
GHPWYLCTLAAAEQLYDALYQWERLGSLAVTNISLAFFQDLYPSATVGTYAKDTSTFASI
TAAVRDYADGFLRVVQKYTPPNGALAEQFSRYDGSPVSAQDLTWSYTSFLTAVQARRRAL
NPSASHIQPLLPNATTATALPQVCTPSSARGPYRPVKRIKWPSPECLSPRRTVAVRFNVL
ATTVIGEDIFLVGSIPALGEWDARHQALKLEANEYSSITPLWYGTVMLDAGEEFEYKFIR
KRVGDGKVIWEEGQNRAFVVPNECGPSNATINAVWRW
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgaaacaccgcgtctggccgagatgacgaggaggcagttcctgacgatcgcc
ataggcgtcttgaccactgtcagcgccctctcggaccccgctcagattgtgatcccagca
acaataacaccccagacgacggatcccttggtgtcatggttagcgcaggaaacttcatat
gccctcgatggtgtgttcaacaatatcggaccgaacggggccaaggcgaccggcgctagc
tctggcatcgtcatcgctagtcctagtcaaagcaatccggactactactatacctggact
cgagatgccgctctcaccatcaaacacctcgttggttcttttgccgccgatcacgatcct
gcactccaaaggatcatagaggattacatagattcccaggcgcacttgcagactgtctct
aacccttccggaaatctttcaagcggaggcttgggggaacccaagttgagggtggatgga
tcggcattccgtggctcctgggggcgtccacagagtgatgggcccgcgctgagagcaaca
acattgatatcctacgcaaacttgatgattgataatggttatttctctacggttgagtca
agcgtctggccaatcattcagaacgacctttcctatctgacggaattttggaactcttct
acttttgatctttgggaggaagttcgcggctcctcatttttcaccacggcagtccagcat
caagccctcagccaaggtgcagctcttacccagagccttggtaaaacctgttcgaactgc
cagtcacaggcaccgcaggttctctgtttcctgcagacttactggactggctcgtccata
ctggccaatctgtatagtgatcggtccgggaaagatgccagttcaatactaggcatcata
catacttttgaccccaatgcgggctgcgacggagagacgttccaaccgtgttctgagcgg
gcgcttgcaagccacaaagaagtcgtagactccttccgctcgctctacccgatcaatgca
gacatccctcagggccaagctgtagccgtgggtcggtacccagaggatgtctatcaaggt
ggacacccttggtatctgtgcactttggcagcagctgagcagctatacgatgcactttat
cagtgggagaggttggggtccctcgccgttacaaatataagcctcgcgttcttccaggac
ttgtacccatcagctacagttgggacctacgcgaaggacaccagcacatttgcctctata
actgcagcagttcgagattacgcagatggatttctccgcgtcgtgcaaaaatacacaccc
ccgaatggcgccctcgcagagcaattctcgcgctacgacggctcccccgtctcagcgcaa
gacctcacttggtcctacacatcctttcttactgcagttcaagcccgaagacgtgctctt
aatccttccgcatcacacatccaacctctcctcccaaacgcaaccaccgccaccgccctc
ccccaagtctgcaccccttcctccgcacgaggaccctaccgccccgttaaacgaatcaag
tggcccagcccagagtgcctctccccccggcgtaccgtcgcagttcggttcaatgtgctg
gcgaccaccgtcattggcgaggacatcttcctcgtcgggtccatccccgcgctgggcgaa
tgggatgcgcggcatcaggcattgaagttggaagcgaatgagtactcgagcatcacgccc
ttgtggtacgggaccgtgatgttggatgctggggaggagtttgaatacaaatttattcgg
aagagggtgggagatggtaaggttatctgggaagaagggcagaatcgagcatttgtggtg
ccgaatgagtgcggcccttccaatgccacgatcaatgccgtctggagatggtga

DBGET integrated database retrieval system