KEGG   Aspergillus fischeri: NFIA_105920Help
Entry
NFIA_105920       CDS       T01070                                 

Definition
(RefSeq) alpha-amylase, putative
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_105920
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NFIA_105920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 Aminotran_5 AroM
Motif
Other DBs
NCBI-GeneID: 4593921
NCBI-ProteinID: XP_001267001
UniProt: A1CWV2
LinkDB All DBs
AA seq 422 aa AA seqDB search
MGFTAIWITPVTEQLPQDTSEGTAYHGYWQQDIYSVNSNYGTADDLKALASALHDRGMYL
MVDVVANHMGYAGAGDSVDYSVFKPFNSQAYFHPLCFISNYDNQKDVEDCWLGDNVVPLP
DLNTTNSDVQKIWYNWVTSLVSNYSIDGLRIDTVKHVQNDFWPGFNDAAGVYCIGEVFDG
DPAYTCPYQEVLDGVLNYPIYYPLLKAFQSTSGSMSGLYDMINTVKSQCADSTLLGTFVE
NHDTPRFASYTNDMALAKNAAAFIILSDGIPIIYAGQEQHYSGGTDPANREAVWLSGYSK
TSELYKLIATANAIRNHAISKDPGYMTYKNNPIYKDTSTIAMRKGSDGAQVITVLSNLGA
SGSSYTLSLSGTGYEAGQQLTEVFSCTTVTVGSDGKVPVPMASGLPRVFYPTAGLDGSTI
CT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgggctttacagcaatctggataaccccggtcaccgagcaacttccccaggacacatcg
gaaggcactgcataccacgggtactggcagcaagacatttattcggtcaattccaactat
gggaccgctgacgacctgaaagccctggcgtcagctcttcacgacaggggcatgtatctc
atggtcgacgttgttgccaatcacatgggatatgccggtgcaggcgattcggtcgactat
agtgtcttcaaacctttcaactctcaggcctacttccatccgttgtgcttcatcagcaac
tacgataatcagaaagacgtggaagattgctggttgggagacaatgttgttcctttaccg
gatcttaatactacaaattcggatgtccaaaagatttggtacaattgggtgacctcttta
gtgtctaattattccatcgacggcctacgaattgacactgtgaagcacgtccagaatgat
ttctggccggggttcaatgacgctgcaggtgtctactgcatcggggaggtatttgatgga
gatccagcgtacacttgcccctaccaagaggtcctggacggcgtgctgaattaccctata
tattatccgcttctgaaagccttccaatccacaagtggcagtatgagcggcctctacgat
atgatcaacacggtcaagtcgcagtgcgccgattcgacgctgttgggcacctttgtcgaa
aatcacgatactccccggttcgcatcgtataccaacgacatggccctcgccaaaaacgcc
gcagcattcatcatcctctccgatggaatcccaatcatctacgccggccaggagcagcat
tacagcggtggcacggatcccgcaaaccgcgaggcagtctggctatccggctactcaaaa
acgagcgagctatacaagctcatcgcgacagcaaacgccatccggaatcacgccattagc
aaggacccaggatacatgacttataagaataaccccatctacaaagatacctccaccatc
gccatgcggaaaggctccgacggagcgcaggtcatcaccgtcctctcgaacctcggtgct
tccggaagctcctacacgctctcactgagcggaacaggctatgaggccggacaacaactg
actgaggtgttctcctgcaccacggtgaccgtaggctcagacgggaaggtccccgttccc
atggctagtggcttgccccgggtgttttacccaacggctgggctggacggaagtacaatt
tgtacttga

DBGET integrated database retrieval system