KEGG   Nostoc flagelliforme: COO91_00327Help
Entry
COO91_00327       CDS       T05266                                 

Definition
(GenBank) SOD2, superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nfl  Nostoc flagelliforme
Brite
Enzymes [BR:nfl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COO91_00327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Motif
Other DBs
NCBI-ProteinID: AUB34504
UniProt: A0A2K8SGB2
LinkDB All DBs
Position
complement(322382..322984)
Genome map
AA seq 200 aa AA seqDB search
MAFVQDPLPFDINALEPHGMKAETFEYHYGKHHKAYVDNLNKLTEGTELANKSLEEVIKT
SFNDSSKAGIFNNAAQVWNHTFFWNSLKPAGGGAPTGDLAAKIDKDFGSFDKFKEEFSNA
AATQFGSGWSWLIDDGGTLKVIKTPNAENPLAHGKKALLTLDVWEHAYYIDFRNARPAFI
KNFLDNLVNWDFAAENLAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgtacaagacccattacccttcgatattaatgctctagagccacatggcatg
aaagctgaaacttttgagtatcactatggcaagcatcacaaagcttatgtagacaacctc
aacaagctcactgaaggtacagaacttgctaataagtctctggaagaggtgatcaaaact
tccttcaacgactcctctaaagcgggaatcttcaacaacgctgcccaagtttggaaccac
accttcttttggaattccttgaaaccagcaggtggcggcgcacccactggtgatctcgca
gccaaaattgataaagattttggtagcttcgacaaattcaaggaagagttctcgaacgca
gccgcaacccaattcggtagtggctggtcttggctcattgatgatggtggtacgctgaag
gtgatcaaaacaccaaatgcagaaaaccctctagctcatggtaagaaagcactcctaacc
ttagatgtttgggaacacgcctactacattgactttagaaacgcccgtccggcattcatc
aagaatttcctagataacttggtcaactgggactttgctgctgaaaacttggccaaagct
taa

DBGET integrated database retrieval system