KEGG   Nostoc flagelliforme: COO91_02470Help
Entry
COO91_02470       CDS       T05266                                 

Definition
(GenBank) ppc, phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00620  Pyruvate metabolism
nfl00680  Methane metabolism
nfl00710  Carbon fixation in photosynthetic organisms
nfl01100  Metabolic pathways
nfl01120  Microbial metabolism in diverse environments
nfl01200  Carbon metabolism
Module
nfl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COO91_02470
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COO91_02470
   00680 Methane metabolism
    COO91_02470
Enzymes [BR:nfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     COO91_02470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUB36555
UniProt: A0A2K8SNY8
LinkDB All DBs
Position
complement(2303904..2306930)
Genome map
AA seq 1008 aa AA seqDB search
MRHRLQVVEELWESVLRQECGQNMVDLLRELRDLCSPEGQATNDQASSAVKLIEQLNINE
AIRAARAFALYFQLINIIEQEYEQRQQLSRYEVETEPTDAEIASNVNYSSNQREDDAPVS
RGIAAELLRKNYLEKAQVKPKGTFAALFPYLFKLNVPPQQIQRLIAHLDVRLVFTAHPTE
IVRHTIRDKQRQVVQLLQKLDALENHSGATAGGYAWEAADVREQLLEEIRLWWRTDELHQ
FKPTVLDEVDYALHYFQEVLFDGIPQLYKRFKHTLSNTFPWLEPPSKNFCSFGSWVGSDR
DGNPSVTPEITWQTACYQRKMVLGRYIQSVKNLIELLSVSMHWSDVLPDLLESLELDQSQ
LSEVYDALALRYRQEPYRLKLAYVLKRLENTRDRNLALYNRETPKNQDSPLYLSGDDFLA
ELRMIQRNLTETGLSCRELENLICQVEIFGFNLTQLDIRQESSRHADALNEILEYLQILP
QPYNELSEEQRVAWLTGELQTRRPLIPAELPFSEKTNDVIETFRVVRSLQQEFGLNICQT
YIISMCRDVSDVLEVLLLAKEARLFDPAIAVGTIQVVPLFETVEDLQRSRSVMRKLFELP
LYRALLAGGYEQTKTESVVVDENSSSPASPASPAPSPLSPNLQEVMLGYSDSNKDSGFLS
SNWEIHKAQKSLQQIAENYDINLRIFHGRGGSVGRGGGPAYEAILAQPGHSINGRIKITE
QGEVLASKYSLLDLALYHMETITTAVIQASLLRTGFDDIEPWNEIMEELAARSRQHYRAL
IYEQPDFVDFFHEVTPIEEISQLQISSRPARRPSGKKDLTSLRAIPWVFSWTQTRFLLPS
WYGVGTALQEFLNEEPEEHLKLLRYFYVKWPFFKMVISKAEMTLAKVDMQMAHHYVQELS
KPEDQLRFAKVFDQIASEFYLTRDLVLKITDHNRLLDGDPVLQRSVQLRNGTIVPLGFIQ
VSLLKRLRQSLNSTATSGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcatcgtctccaggtagtggaagaattgtgggagtcagttctccggcaagaatgc
ggtcaaaacatggtagacttgttgcgggagttgcgagatttgtgttcaccagaaggacaa
gcaacaaatgaccaagcatcctcagccgtaaaattgattgaacaactaaatatcaacgaa
gcaattcgcgcggctcgtgctttcgctctgtattttcagttgattaacatcatagagcag
gaatacgaacaacggcagcaattgagtcgctatgaggtagagacagagcctacagatgca
gaaatagcatctaatgtcaactattcttctaatcaaagagaagatgacgcgcctgttagc
aggggaatagcagcagagttgctcagaaagaattatctagaaaaagcgcaagtcaaacca
aaaggtacttttgctgccttgtttccctatttattcaaactgaatgtaccaccccagcaa
attcaacgtttaattgcacatctggatgtgcgcttagttttcacagctcacccgacggaa
attgttcgtcataccatccgggataagcagcgccaggtagtacaactcttgcaaaaactc
gatgccttggaaaaccattctggtgctacagctgggggatatgcttgggaagcagcagat
gtgcgcgaacaattgctcgaagaaattcgcctgtggtggcgtacagacgaacttcaccag
ttcaaacccactgtgctagatgaagtagattatgctctacactacttccaagaagtttta
tttgatgggattcctcaactttataaacgtttcaaacacacgttatccaacacctttcct
tggctagaaccaccgagtaaaaacttttgctctttcggttcctgggtaggctcagacagg
gatgggaacccatcagtcacaccagaaattacctggcaaaccgcttgctatcagcgcaaa
atggtgcttggaagatatattcagtcagtgaaaaatctgattgaattattgagtgtgtcc
atgcactggagtgatgtcttaccagatttactggaatctttagagttagatcagtcccag
ttgagtgaggtatatgacgcactggcgctgcgttatcggcaagagccatatcggctcaaa
ctggcttatgtgctgaaacggctagaaaatactcgcgatcgcaatttagctttgtacaat
cgggaaacgccaaaaaatcaagatagtcccctgtatctttcgggagacgattttttagca
gaactgcggatgattcagcgcaacttgacagaaacaggtttaagctgtcgagaattagaa
aatctgatctgtcaagtagaaatttttggttttaacttgacacagctagatattcgccaa
gaatcatcccgccatgccgatgcgctcaatgagatactagaatacctgcaaatattacct
caaccttacaacgaactatccgaggagcaaagagtcgcttggctcacaggagaactgcaa
acccggaggccattaattccggcagaattgccattttctgaaaaaaccaacgatgtaatt
gaaacctttcgcgtcgtgcgatcgctgcaacaagaatttggtctaaatatctgccaaact
tacattatcagcatgtgccgcgacgtgagcgacgtgctagaagtattgctgttagccaaa
gaagccagactttttgaccccgccattgctgtcggaacaattcaagttgtccccctattt
gagacagtagaagacttacaacgctccagaagcgtcatgcggaaactgtttgaactaccc
ttgtatcgagctttattagctggcggctacgaacagacaaaaacagagagtgttgttgtg
gatgaaaattcatcctcccctgcctcccctgcctctccagcaccctcccccctctcccca
aacttacaagaagtaatgctggggtattctgatagcaacaaagactctgggtttttaagc
agcaactgggaaattcataaagcccaaaaatcactgcaacaaatagcagaaaactacgat
ataaatttgcgaattttccacggacgcggcggttctgtaggacggggtggtggtcctgct
tacgaggcgattttggctcaaccgggtcatagtatcaatgggcgaatcaagattaccgaa
caaggagaagttttggcttctaaatactccttgttggacttggcattgtaccacatggag
accattaccactgctgtgattcaagctagtctactgcgaacagggtttgatgatattgaa
ccctggaatgagattatggaagaattagcagcgcgatcgcgtcaacattatcgtgcttta
atctacgaacagcctgattttgttgacttcttccacgaagtaactcccattgaagaaatt
agccagctacaaattagttctcgtccagcccgccgtccatctggtaagaaagatttaact
agtctgcgagctattccttgggtatttagctggacacaaacccgctttttacttccttcc
tggtacggcgttggcacagctttacaagaattcttgaatgaagaaccagaagaacacttg
aaattgctgcgctacttttacgttaaatggccgttcttcaagatggtgatttctaaagct
gagatgaccttggcaaaagtagatatgcaaatggcacatcactacgtccaggaattatca
aaaccagaagatcaacttcgttttgcgaaagtttttgaccaaattgctagcgagttctat
ctcacaagggatttggtattaaaaatcaccgatcacaatcgactcttagatggcgatcct
gtcttgcaacgatctgtgcagttacgcaatggcacaattgtccccttgggatttatccaa
gtttcactgctcaagcgcctacggcagtcgctaaatagtactgctacttctggagtcatt
cactctcgttacagcaaaggcgagttactgcgaggagcattgttaactatcaatgggatt
gctgctgggatgagaaatacaggttga

DBGET integrated database retrieval system