KEGG   Nostoc flagelliforme: COO91_02841
Entry
COO91_02841       CDS       T05266                                 

Definition
(GenBank) DLAT, pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00010  Glycolysis / Gluconeogenesis
nfl00020  Citrate cycle (TCA cycle)
nfl00620  Pyruvate metabolism
nfl01100  Metabolic pathways
nfl01110  Biosynthesis of secondary metabolites
nfl01120  Microbial metabolism in diverse environments
nfl01200  Carbon metabolism
Module
nfl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COO91_02841
   00020 Citrate cycle (TCA cycle)
    COO91_02841
   00620 Pyruvate metabolism
    COO91_02841
Enzymes [BR:nfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     COO91_02841
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase MadL
Other DBs
NCBI-ProteinID: AUB36912
UniProt: A0A2K8SN83
LinkDB
Position
complement(2651967..2653178)
AA seq 403 aa
MEKGETVVVVESDKADMDVETFYEGFLAHIIVEAGETAPVGSAIAFIAETEAEIEQAKSL
ANSGGVAATTTASPEPVPAAASAATPALASQNGSNHKEGRLVASPRARKLAKELKVDLTT
LQGSGPHGRIVAEDVEALSNKGKQPAPAPVAPPAPVPTSAPVAPPAPRTPAPAPVVAAIP
GQTVPLTTFQNAVVRNMVATISVPVFRVGYTITTDGLDKLYKQIKSKGVTMTALLAKAVA
VTLQKHPLLNASYSDQGIVYHSDINISVAVAMDDGGLITPVLQNADAVDIYSLSRTWKSL
VERARTKQLQPQEYNSGTFTLSNLGMFGVDKFDAILPPGQGSILAIGASRPQVVATPDGL
FGVRQQMQVNITSDHRIIYGAHAAAFLQDLAKLIETNPQSLTL
NT seq 1212 nt   +upstreamnt  +downstreamnt
gtggaaaaaggcgaaacagtggtggttgtagagtcagataaggcagatatggatgtagaa
accttttatgagggatttcttgcccatatcatagttgaagctggtgaaactgccccggta
ggatctgccatcgccttcattgccgaaacggaagctgaaattgaacaggcgaaatctctt
gccaattccggcggcgtggctgctactactaccgcttcccctgaaccagtccccgccgca
gcttcagctgccacacctgccttagcgtctcaaaacgggtctaaccacaaagaaggaagg
cttgtagcttcaccccgggcccgcaagttagccaaagaactcaaagttgatttaactaca
ctccaaggcagtggcccccacggtcgcattgtcgccgaagatgtggaagcattgtcaaat
aaaggcaaacaacccgcccctgccccagttgccccaccagcacccgtaccaaccagcgcc
ccagttgcacccccagcacctcgcacaccagcacccgcgccagtggtagcggctattcct
ggccaaactgtacctctaactaccttccaaaatgccgtagtgcggaacatggtagctacc
atatccgtgcccgtcttccgtgtcggttatacaattaccactgatgggttagacaaactt
tataaacaaattaaatctaaaggcgtgacaatgacagcgctactggcgaaagctgtagca
gtgacattgcaaaaacacccattgttaaatgctagctactcagaccagggtattgtttat
cattctgatatcaacatttctgtagctgtggcgatggatgatggcggattaattacacct
gtgctgcaaaatgcagacgcagtggatatttattctctatcgcgtacttggaaatctttg
gtagaacgtgcgaggacaaaacaactacagcctcaagaatacaacagtggtacttttacc
ctgtccaatttggggatgtttggcgtagataaatttgatgcgatcttaccacctggacaa
ggttcaattttagcgatcggggcatcacgtccgcaagtggtagcaacacccgacggttta
tttggcgtgcggcaacaaatgcaagtaaatattacttctgaccaccggattatttacggt
gcccatgctgcggcgttcttgcaagatttagcgaaattgattgagacaaatcctcaatct
ttgacactgtag

DBGET integrated database retrieval system