KEGG   Nostoc flagelliforme: COO91_02841Help
Entry
COO91_02841       CDS       T05266                                 

Definition
(GenBank) DLAT, pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00010  Glycolysis / Gluconeogenesis
nfl00020  Citrate cycle (TCA cycle)
nfl00620  Pyruvate metabolism
nfl01100  Metabolic pathways
nfl01110  Biosynthesis of secondary metabolites
nfl01120  Microbial metabolism in diverse environments
nfl01130  Biosynthesis of antibiotics
nfl01200  Carbon metabolism
Module
nfl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COO91_02841
   00020 Citrate cycle (TCA cycle)
    COO91_02841
   00620 Pyruvate metabolism
    COO91_02841
Enzymes [BR:nfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     COO91_02841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl AATase MadL
Motif
Other DBs
NCBI-ProteinID: AUB36912
UniProt: A0A2K8SN83
LinkDB All DBs
Position
complement(2651967..2653178)
Genome map
AA seq 403 aa AA seqDB search
MEKGETVVVVESDKADMDVETFYEGFLAHIIVEAGETAPVGSAIAFIAETEAEIEQAKSL
ANSGGVAATTTASPEPVPAAASAATPALASQNGSNHKEGRLVASPRARKLAKELKVDLTT
LQGSGPHGRIVAEDVEALSNKGKQPAPAPVAPPAPVPTSAPVAPPAPRTPAPAPVVAAIP
GQTVPLTTFQNAVVRNMVATISVPVFRVGYTITTDGLDKLYKQIKSKGVTMTALLAKAVA
VTLQKHPLLNASYSDQGIVYHSDINISVAVAMDDGGLITPVLQNADAVDIYSLSRTWKSL
VERARTKQLQPQEYNSGTFTLSNLGMFGVDKFDAILPPGQGSILAIGASRPQVVATPDGL
FGVRQQMQVNITSDHRIIYGAHAAAFLQDLAKLIETNPQSLTL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaggcgaaacagtggtggttgtagagtcagataaggcagatatggatgtagaa
accttttatgagggatttcttgcccatatcatagttgaagctggtgaaactgccccggta
ggatctgccatcgccttcattgccgaaacggaagctgaaattgaacaggcgaaatctctt
gccaattccggcggcgtggctgctactactaccgcttcccctgaaccagtccccgccgca
gcttcagctgccacacctgccttagcgtctcaaaacgggtctaaccacaaagaaggaagg
cttgtagcttcaccccgggcccgcaagttagccaaagaactcaaagttgatttaactaca
ctccaaggcagtggcccccacggtcgcattgtcgccgaagatgtggaagcattgtcaaat
aaaggcaaacaacccgcccctgccccagttgccccaccagcacccgtaccaaccagcgcc
ccagttgcacccccagcacctcgcacaccagcacccgcgccagtggtagcggctattcct
ggccaaactgtacctctaactaccttccaaaatgccgtagtgcggaacatggtagctacc
atatccgtgcccgtcttccgtgtcggttatacaattaccactgatgggttagacaaactt
tataaacaaattaaatctaaaggcgtgacaatgacagcgctactggcgaaagctgtagca
gtgacattgcaaaaacacccattgttaaatgctagctactcagaccagggtattgtttat
cattctgatatcaacatttctgtagctgtggcgatggatgatggcggattaattacacct
gtgctgcaaaatgcagacgcagtggatatttattctctatcgcgtacttggaaatctttg
gtagaacgtgcgaggacaaaacaactacagcctcaagaatacaacagtggtacttttacc
ctgtccaatttggggatgtttggcgtagataaatttgatgcgatcttaccacctggacaa
ggttcaattttagcgatcggggcatcacgtccgcaagtggtagcaacacccgacggttta
tttggcgtgcggcaacaaatgcaagtaaatattacttctgaccaccggattatttacggt
gcccatgctgcggcgttcttgcaagatttagcgaaattgattgagacaaatcctcaatct
ttgacactgtag

DBGET integrated database retrieval system