KEGG   Nostoc flagelliforme: COO91_06148Help
Entry
COO91_06148       CDS       T05266                                 

Definition
(GenBank) GST, glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COO91_06148
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nfl02000]
    COO91_06148
Enzymes [BR:nfl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COO91_06148
Transporters [BR:nfl02000]
 Other Transporters
  Pores ion channels [TC:1]
   COO91_06148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C_5 Glutaredoxin GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AUB40144
UniProt: A0A2K8SXH8
LinkDB All DBs
Position
complement(5734545..5735216)
Genome map
AA seq 223 aa AA seqDB search
MAEIKVYSAVVCPYAHRTRLVLQEKGIDFDLIEIDLQNKPEGFTKVSPYGKVPALTHGDN
RVWESAVINEYLDEVFPNPPLLPSNPAARAQARIWIDFANTRFVPAFSTLLRSSDPQKQE
EAKQELSKHLEFIENEGLAKLSGEGPYWFGESISLVDFTYFPWFERWAALKQYRGFGIPE
EFTRVRQWKHALKERESVKAIAHSKEFYIERYAKFAAPTLAAV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatcaaagtatacagtgcagttgtttgtccttatgctcaccgtactcgcttg
gtactgcaagagaagggcatcgacttcgatttgattgaaattgatttgcagaataagcct
gaagggtttaccaaagtttctccctatgggaaagtgcctgcactaactcatggtgataac
cgagtttgggaatcagcagtaattaacgagtatcttgatgaggtatttcccaatccacca
ctgttacccagcaatcctgctgctagggcgcaggctcgtatctggatcgattttgctaac
accaggtttgttcctgctttttctaccctgctgcggagttcagatcctcaaaaacaagaa
gaagctaaacaggaactatccaaacacctggaattcattgaaaacgaaggtttggcaaag
ctatctggggaaggcccttactggtttggcgaatctattagtttggtggatttcacctat
ttcccttggtttgagcgctgggctgcattgaagcaatatcgtggttttgggataccagag
gaatttacccgtgtacgtcagtggaaacatgctttgaaagagcgtgaatctgtgaaagcg
atcgctcactctaaggaattctacatcgagcgatatgctaaattcgctgcgcctactctc
gctgctgtttaa

DBGET integrated database retrieval system