KEGG   Nostoc flagelliforme: COO91_08526Help
Entry
COO91_08526       CDS       T05266                                 

Definition
(GenBank) GST, glutathione S-transferase
Organism
nfl  Nostoc flagelliforme
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AUB42398
UniProt: A0A2K8T3U8
LinkDB All DBs
Position
complement(7871519..7872190)
Genome map
AA seq 223 aa AA seqDB search
MSNIQLYFAKASTFSQRTRVVLLEKGIDFTPIEIDLQNKPDGYTQISHYGKVPAIKHGDV
EIYESAIINEYLDEVFPEPPLLPRDPAAKAIARIWIDYANTRLVPAFNKFLRGKDSQEQE
QGRREFTEVLLYIEQEGLGKGDYLLGDQFSLVDISFYPWFERLPLLEHFRKFTLPAETPR
LQTWWNLVGDRSSIQAVANPVDFYLQRFAKVLGEPVPVGAVQK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatacaactgtacttcgccaaagcctctactttctctcaacggactcgtgta
gtcttactggaaaagggcattgactttacccccatagaaattgatttacagaacaaacca
gatgggtacacacagatttcccactatggcaaagtcccagccatcaaacatggggatgtt
gaaatttacgagtctgccatcatcaatgaatatctagatgaagtcttcccggagccacct
ttattaccccgcgatcccgcagctaaagcgatcgctcgcatctggatagactacgccaat
actcgccttgtcccagcttttaacaaatttctgcgcggtaaagatagccaagaacaggaa
caagggcgaagagagttcacagaagtacttctatatattgaacaagaaggattaggcaaa
ggtgattacttgttaggagatcagtttagtcttgttgatatcagcttctatccttggttt
gaacgtttaccactcttagaacacttccgcaaattcacactaccagcagaaacacctcgt
ttgcagacatggtggaatctggtaggcgatcgctcctcaattcaagcagtagcaaatcct
gtggacttctatttgcaaagattcgccaaagttcttggtgaacctgttcccgttggtgca
gttcaaaaatag

DBGET integrated database retrieval system