KEGG   Nostoc flagelliforme: COO91_08946Help
Entry
COO91_08946       CDS       T05266                                 

Definition
(GenBank) starch phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
nfl  Nostoc flagelliforme
Pathway
nfl00500  Starch and sucrose metabolism
nfl01100  Metabolic pathways
nfl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COO91_08946
Enzymes [BR:nfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     COO91_08946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AUB42800
UniProt: A0A2K8T596
LinkDB All DBs
Position
8237738..8240302
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPPRLEPLRRLAYNLHWDWNVDTKDLFRRLDSDLWESSHHNPVLMLGT
ISQSRLLEVVEDEGFLAQMDRADRQLDDYLQERTWYQKQREHKPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYLSNDFYNM
PLHLERNPDGSELRIAVDYPGRKVYARVWRVQVGMVPLYLMDTNIEPNNTYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGLKVTAYHMNEGHAAFSALERIRLLIQEEGLNYPQ
AKQVVASSNIFTTHTPVPAGIDLFAPEKMLYYLGYYAEIFGLPKEQFLGLGRENTGDLSG
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKNVPVEEVPIAAITNGVHARSCVAKS
TQELYDRYLGPNWSSAPPDSPLWDRMDAIPDEELWRNHERCRLDMILYVREHLVKHLTDR
GASASEITQAQEVLDPYAFTIGFARRFATYKRATLWMRDLDRIKRLLLANKDRKVQFVIA
GKAHPKDIPGKELIREINHFIREQHLEKQVVFVPNYDIHISRLMVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWAIGHGENYDDPNYQDEVEANALYELL
EKEVVPLFYEHRDTDGLPRPWVAKMKDAIRLNCPFFNTARMVGEYAQRAYFPASDRYHTL
TVDNYAPAKELAAWKEKLGEHWFNIRIKDVDVSAASDIEVNQTVAVKAKVDLATLTNDDV
QVELYQGAIDANGDIVNAVPVVMDYQGEDAQQLSIYTGNITYTASGLQGLSLRVLPKNQY
LANPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgtacatttaacgtatccccttcactaccgccgcgactcgaaccacta
cggcggctggcatataacttgcactgggattggaacgttgacactaaagatttatttcgt
cgcttagactctgacctttgggagtctagccatcataatccggtgttgatgctgggtact
atctctcaatcgcggcttctggaagttgtcgaagatgaaggcttcctagcgcaaatggat
cgagctgaccgtcagttagacgattatttgcaagagcgtacctggtatcagaaacaacgg
gagcataaaccaaaagagtgctacgcctatttttcggcggaatttggacttgtagattgt
ttgcccgtctattctgggggcttgggcgttctggcgggggatcacctcaaatctgccagt
gatttagggctaccccttgtgggcgtaggtttactatatcagcaaggctactttgcccag
tatctcaatgccgatggctggcagcaagaacgctacttgagcaatgatttctacaatatg
cccttgcatctagagcgtaatcctgatggttcagaattgcgaattgcggtagattatcca
ggacgcaaggtgtatgccagagtttggcgcgtacaggtgggaatggtgcccctgtatttg
atggacaccaacattgaacccaacaacacttacgatcacgacatcacagaccagctgtat
ggtggcgacatcgatatgcgtatccaccaggaaatcatgctggggatcggtggtgtacaa
atgctcaaagctttggggctgaaagttaccgcttaccacatgaatgaaggccacgccgcc
ttctctgccctagaacgcatccgcttgctgattcaggaagaaggactgaattatccccaa
gctaaacaggtggtggcttccagtaatatctttactacccacacgccagtaccagcaggg
attgacttattcgctcctgaaaaaatgctgtactacttggggtactatgcagagatattt
gggttgcccaaagagcaatttttaggactggggcgcgagaatacaggcgatttatctggg
cctttcagtatggcggtgctggcgctgaagatggcaacattttctaacggtgtcgcccaa
ctgcatggtgtggtgtcgcggcaaatgttccagggcttgtggaagaatgtgccagtggaa
gaagtgccgatcgcagcaattactaatggtgtccatgctcggagttgtgttgcgaaatct
actcaagagttgtacgatcgctacctggggccaaactggtcatcagcaccaccagatagc
ccattgtgggatcggatggatgccataccggatgaagaattgtggcgcaatcacgaacgc
tgccgcttggatatgattttgtatgtgcgggagcatttggtcaagcatttaaccgatcgc
ggcgcttccgcctccgaaattacccaggcacaagaagttttagatccttacgctttcacc
atcggctttgctcgtcggtttgccacctacaaacgcgctaccctgtggatgcgtgatttg
gatcggattaagcggcttctgctggctaacaaagaccggaaagtgcaattcgtgattgct
ggtaaggcacatcccaaagatattcccggtaaagaactcatccgcgagatcaatcacttt
atccgcgaacaacatttagaaaaacaggtagtgtttgttcccaattacgacattcacata
tcccggttgatggttgcgggttgcgatatctggttaaacacaccgcgtcgtccacgggaa
gcctctggtactagtggcatgaaagcagcaatgaatggattgccaaatttaagtgtacta
gatggctggtgggatgaagctgattacgtccgcacaggctgggcaattggacatggagag
aattacgacgatcccaactaccaagatgaagtagaagcaaatgctctttacgaattgtta
gagaaggaagttgtacccctattttatgaacatcgggatactgatggtttgccccgtccg
tgggttgccaaaatgaaggatgcaattcgattgaattgtcccttctttaatacagcgcgg
atggtaggagaatatgcacaaagggcttatttcccggctagcgatcgctatcataccctg
actgttgataactatgccccagctaaagaactagctgcttggaaagaaaaactgggtgaa
cactggtttaacattagaatcaaagatgttgacgtatcggcagcttcagacattgaggtt
aaccaaaccgttgctgtcaaagccaaggttgacttagcaaccttgacgaatgatgatgtg
caggtggagttatatcaaggtgcgatcgatgccaatggtgatattgtcaacgctgtgcca
gtggtgatggattatcaaggtgaagatgcacagcaattgagtatttacacgggtaatatc
acttatactgcttctggtttgcaaggcttgtctttgcgtgtattgccgaagaatcaatac
ctggctaatccctatgaaccaaggttgattgcttgggcagaataa

DBGET integrated database retrieval system