KEGG   Nocardia farcinica NCTC11134: ERS450000_00335Help
Entry
ERS450000_00335   CDS       T04524                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00250  Alanine, aspartate and glutamate metabolism
nfr00280  Valine, leucine and isoleucine degradation
nfr00310  Lysine degradation
nfr00410  beta-Alanine metabolism
nfr00640  Propanoate metabolism
nfr00650  Butanoate metabolism
nfr01100  Metabolic pathways
nfr01120  Microbial metabolism in diverse environments
Module
nfr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ERS450000_00335 (gabT)
   00650 Butanoate metabolism
    ERS450000_00335 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ERS450000_00335 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ERS450000_00335 (gabT)
   00310 Lysine degradation
    ERS450000_00335 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ERS450000_00335 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nfr01007]
    ERS450000_00335 (gabT)
Enzymes [BR:nfr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ERS450000_00335 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ERS450000_00335 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ERS450000_00335 (gabT)
Amino acid related enzymes [BR:nfr01007]
 Aminotransferase (transaminase)
  Class III
   ERS450000_00335 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CRY73827
UniProt: A0A0H5NF81
LinkDB All DBs
Position
1:complement(284974..286338)
Genome map
AA seq 454 aa AA seqDB search
MTVLDYRLPQQRKLITDLPGPASRAIAERRRASVAAGVGSSLPVYAADADGGVVVDVDGN
SLVDLGSGIAVTSVGAAHPAVVEAVRAQAGHFTHTCFMVTPYEGYVRVAEELAALTPGTH
DKRTVLFNSGAEAVENAIKVARLATGRTAVVVFDHAYHGRTNLTMALTAKSMPYKAHFGP
FAPEIYRMPMSYPFRDGAALDGPAAAQRVIDRIEKQIGADAVAAIVLEPIQGEGGFIVPA
PGFLPALAAWARANGVVFIADEVQTGFARTGAWFACDHEQVVPDIIALAKGIAGGLPLAA
ITGRAELLDRVHPGGLGGTYGGNPIACAAALATIATMRELDLPARARHIERIVTGRLRAL
AAEIPAIGDVRGRGAMLAMEFVVPGTTEPDAALTRAVAAGALEQGVILLTCGTDGNVVRL
LPPLVIGDELLTDALDVLDDVVRAAARNRAERTR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcctcgactaccggcttccgcagcagcgcaagctgatcaccgacctgcccggc
ccggcatcgcgggccatcgccgaacgccgccgcgccagcgtcgcggccggtgtcgggtcc
agccttccggtctacgccgccgacgccgacggcggtgtggtggtcgacgtcgacggcaac
tcgctcgtcgatctgggctcgggcatcgcggtcacctcggtgggcgcggcccatcccgcc
gtcgtcgaggcggtacgcgcccaggccgggcacttcacccacacgtgcttcatggtcacc
ccgtacgaggggtacgtgcgggtcgccgaggaactcgcggcgctcacgcccggcacgcac
gacaagcgcaccgtgctgttcaactccggcgccgaggcggtggagaacgcgatcaaggtg
gcgcggctggccaccgggcgcaccgccgtggtcgtcttcgaccacgcctaccacgggcgc
accaacctgacgatggcgctgaccgccaagtccatgccgtacaaggcgcacttcggaccg
ttcgccccggagatctaccggatgccgatgtcgtatccgttccgcgacggcgcggccctg
gacggtccggcggccgcccagcgggtgatcgaccggatcgagaaacagatcggtgccgac
gcggtcgccgcgatcgtgctcgaaccgattcagggcgagggcggattcatcgttcccgca
ccgggtttcctgcccgccctggccgcctgggcgcgcgcgaacggcgtcgtgttcatcgcc
gacgaggtgcagaccggcttcgcccgcaccggcgcgtggttcgcctgcgaccacgaacag
gtcgtgcccgacatcatcgccctggccaagggcatcgcgggcgggctgccgctggcggcg
atcaccgggcgcgccgagctgctcgaccgcgtccatcccggcggcctgggcggcacctac
ggcggcaacccgatcgcgtgcgcggcggcgctcgccaccatcgcgaccatgcgcgagctg
gatctgcccgcgcgcgcccggcacatcgagcggatcgtgaccggccgcctgcgggcgctg
gccgcggagattccggcgatcggcgacgtgcgcgggcgcggcgcgatgctggcgatggag
ttcgtggtgcccggcaccacggagccggatgccgcactcacgcgcgcggtcgccgccggc
gcgctcgagcagggcgtgatcctgttgacctgcggcacggacggcaacgtggtgcggctg
ctgccgccgctggtcatcggcgacgagctgctcaccgacgcgctcgacgtgctcgacgac
gtcgtgcgcgccgccgcccggaaccgagcggagcggacccgatga

DBGET integrated database retrieval system