KEGG   Nocardia farcinica NCTC11134: ERS450000_00418Help
Entry
ERS450000_00418   CDS       T04524                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01130  Biosynthesis of antibiotics
nfr01230  Biosynthesis of amino acids
Module
nfr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ERS450000_00418 (aroK)
Enzymes [BR:nfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ERS450000_00418 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA Cytidylate_kin2 Cytidylate_kin AAA_24 RuvB_N AAA_17 AAA_28 AAA_16 AAA_22 Rad17 AAA_5 ABC_tran Zeta_toxin MMR_HSR1 RNA_helicase NTPase_1
Motif
Other DBs
NCBI-ProteinID: CRY73983
UniProt: A0A0H5NEH9
LinkDB All DBs
Position
1:complement(372912..374384)
Genome map
AA seq 490 aa AA seqDB search
MIVQTDPRAPRVVLVGPPGAGKSTIGRKLAKELGVDLYDTDAGIERETGRTIPEIFAADG
EPEFRRIEERVVRRAILAERGVVSLGGGAVLSANTRALLRNRTVVYLEISVAEGLRRTGA
SNQRPLLNGDDPGAKYRELMRTRRPLYREVATVRVRTDGRSPSRVVRMILTKLGIDPVVP
ATEPEPAENTASPATPNSRAGSRSRARRRARARAAARRRAAAEGGTPDPDAPSSAAAGQV
VDGSGSLTPAATTAPDPAPPTTRSAARDAAAPAAESPTAGRPAAPTPGSSPDPTASATAM
PTEAPGADQDSTRDARHHASTPGRAPVRRRPRRRRGRSTDPTSTDRRDRATTSDAPPVDE
TTDTAASTPGRPDRSPDRPRARRSGDRTRHAAPRSTRAPADRPANDAATGPGPDGPDAHI
PQHDGADPRELSAPRSPSSTDEKPSTATSSAPRSGAGGSTSTGGRSRRARARRARGRAPK
QARTESEQQS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtccagaccgacccgcgcgcgccgcgtgtggtgctggtcggaccgccgggggcg
ggcaaatccacgatcggccgcaagctcgcgaaagaactgggcgtcgacctctacgacacc
gacgccgggatcgaacgcgagaccggtcgcaccatcccggagatcttcgccgccgacggc
gagcccgagttccgccggatcgaggagcgcgtggtgcgccgggcgatcctcgccgaacgc
ggcgtggtctccctcggcgggggcgcggtgttgtcggcgaacaccagggcgctcttgcgc
aaccgcaccgtggtgtatctggagatcagcgtggccgaggggctgcgccgcaccggtgcg
agcaatcagcgcccgctgctcaacggcgacgaccccggcgcgaagtaccgcgagctgatg
cgcacccgccgcccgctctaccgggaggtcgccacggtgcgcgtgcgcaccgacggccgc
agccccagccgggtggtccggatgatcctgacgaagctcggcatcgacccggtggtcccg
gcgacggagcccgaaccggccgagaacaccgcctcgccggccacgccgaactcgcgagcg
ggcagtcgttctcgcgcccgccgacgcgcccgtgcccgggcggcagcccgccgacgcgcc
gccgccgagggcggcacgccggaccccgacgcgccgtcatcggcggcggccgggcaggtc
gtcgacggttcgggcagcctcacccccgcggccacgaccgcgccggacccggccccgccg
acgacccgctcggccgcgcgggacgcggcagcaccggcagccgagtcccccaccgcgggt
cgaccggccgccccgacgccgggcagctcaccggaccccacggcttccgcaacggcgatg
cccacggaagctcccggcgccgaccaggattcgacccgcgatgcccggcaccacgcgagc
acgccgggacgcgcccccgtccgccgacgaccacgacggcgccgcggccgcagcaccgat
ccgacgtcgaccgaccgcagagaccgcgcgacgacctccgacgccccgcccgtcgacgag
acgaccgacaccgccgcgtccacacccggccggcccgaccgctcccccgaccggccgcgc
gcacgccggtccggtgaccgcacccgtcatgccgctccccgcagcacacgcgcgcctgcg
gaccggcccgcgaacgacgcggcgaccggccccggtcccgacggtccggacgcccatatc
ccgcagcacgacggggcggatccgcgcgagctctccgcgccacggtccccgtcgagcacc
gacgagaagcccagtaccgcaacctcttccgctccccgttccggtgcgggcggatcgacc
tccaccggcgggcgcagccggcgcgctcgcgcccggcgcgctcgcgggcgcgcacccaag
caggcacgaacagaatcggagcagcagtcgtga

DBGET integrated database retrieval system