KEGG   Nocardia farcinica NCTC11134: ERS450000_00509Help
Entry
ERS450000_00509   CDS       T04524                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00250  Alanine, aspartate and glutamate metabolism
nfr00410  beta-Alanine metabolism
nfr00430  Taurine and hypotaurine metabolism
nfr00650  Butanoate metabolism
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01120  Microbial metabolism in diverse environments
nfr02024  Quorum sensing
Module
nfr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ERS450000_00509 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ERS450000_00509 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ERS450000_00509 (gadB)
   00430 Taurine and hypotaurine metabolism
    ERS450000_00509 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ERS450000_00509 (gadB)
Enzymes [BR:nfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ERS450000_00509 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CRY74150
UniProt: A0A0H5NE61
LinkDB All DBs
Position
1:complement(462272..463687)
Genome map
AA seq 471 aa AA seqDB search
MPLSHPSFPQDPGPSEVAVNPVFTREPVSVPRDRLPAGELDADIAYQVVHDELMLDGNAR
LNLATFVTTWMEPSARVLMAECFDKNMIDKDEYPRTADLEQRCVRMLADLWHAADPAHAT
GCSTTGSSEACMLAGLALKRRWQHRRRAAGLSTERPNLVMGANVQVCWEKFADYWDVEAR
LVPMAGDRFHLTAEAALPHCDENTIGVVAVLGSTFDGSYEPVAEICAALDELERQRGWDI
PVHVDGASGAMVAPFCDPDLVWDFRLPRVASVNTSGHKYGLVYPGVGWVVWRDAAALPED
LIFRVNYLGGQMPTFALNFSRPGAQVVAQYYTFLRLGRSGYTRVQQYCRDVATRLADRIA
ALGAFRLLTDGRQLPVFAFTLAEGETGYSVFDVSAALREQGWLVPAYTFPADREDLAVLR
IVVRNGFSHDLADMLLDALAAVLPRLRAQDRPQHGPDTATFAHGAQAPRGH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgtcgcacccctcctttccgcaggatcccgggccgagcgaggtggccgtcaat
cccgtcttcactcgcgaaccggtgtcggtgccgcgggatcggctacccgcgggcgaactc
gacgccgatatcgcctaccaggtggtgcacgacgagttgatgctcgacggcaacgcccgg
ctgaacctggccaccttcgtcaccacgtggatggagccgagcgcgcgggtgctcatggcg
gagtgcttcgacaagaacatgatcgacaaggacgaatacccgcgcaccgccgacctcgag
cagcgctgtgtgcgcatgctcgccgacctctggcacgccgccgatcccgcccacgccacc
ggctgttcgaccaccggttccagcgaggcgtgcatgctggccgggctggcgttgaaacgg
cgctggcagcaccggcgccgggcggccgggttgtccaccgagcgcccgaatctggtgatg
ggagccaatgttcaggtctgctgggagaagttcgccgactactgggatgtggaagccagg
ctggtgccgatggcaggcgaccgcttccacctgaccgcggaggcggcgctgccgcactgc
gacgagaacaccatcggcgtggtcgcggtgctcggctcgaccttcgacggcagttacgaa
ccggtcgccgagatctgcgccgcgctcgacgagctggaacggcagcgcggctgggacatc
ccggtgcacgtcgacggcgcctccggcgcgatggtcgcaccgttctgcgacccggatctg
gtgtgggacttccggttgccgcgggtcgcctccgtcaacacctccgggcacaagtacggg
ctggtgtaccccggggtgggctgggtggtgtggcgcgacgccgcggcgttgccggaggat
ctcatcttccgggtcaactacctcggcggccagatgcccaccttcgcgctgaacttctcc
cgccccggcgcgcaggtcgtcgcccagtactacaccttcctgcggctgggtcgcagcggc
tacacgcgggtccagcagtactgccgcgacgtggcgacccgcctcgccgaccggatcgcc
gccctgggcgcgttccggttgctcaccgacggccgccagctgccggtcttcgcgttcacc
ctcgccgagggcgaaaccggctactcggtgttcgacgtctccgccgcgttgcgcgaacag
ggttggctggtgcccgcctacacctttcccgccgaccgcgaggacctggccgtcctgcgc
atcgtggtccgcaacggattcagccacgacctggccgacatgctgctcgacgccctggcc
gccgtcctcccccgcctgcgcgcccaggaccggccccagcacggcccggacaccgccacc
ttcgcccacggcgcccaggccccgaggggccactga

DBGET integrated database retrieval system