KEGG   Nocardia farcinica NCTC11134: ERS450000_01148Help
Entry
ERS450000_01148   CDS       T04524                                 

Definition
(GenBank) Putative DNA ligase-like protein Rv0938/MT0965
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ERS450000_01148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nfr03400]
    ERS450000_01148
Enzymes [BR:nfr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ERS450000_01148
DNA repair and recombination proteins [BR:nfr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ERS450000_01148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CRY75090
UniProt: A0A0H5NGS6
LinkDB All DBs
Position
1:1146257..1147144
Genome map
AA seq 295 aa AA seqDB search
MKWDGMRAVADAADGQCLLYSRNGKQVAGSFPEIVEAVAAAVGPHRVVLDGEIIAPEGAR
GAPSFSRLQRRMHVRAPTPQLIREVPVLYMLFDLLALDGHATVRLPYTERRDLLARLDIA
RPPLQLSPSWTDVDPAELAAAATDNGLEGLVAKRLDSVYQPGERSRAWLKMPFRRTTEAV
IAGWLPGNGPFQKSFGSLVLGAHDAQGRLVHIGNVGTGWKQSERTRLRQRLDEIARPDSP
FDVPAPRPVAALAHWVSPELVADIEYREATAEGLRHPSWRGLRIDKDPAEITWPA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgggacgggatgcgggcggtggccgacgccgccgacgggcagtgcctgctctac
agtcgcaacggcaagcaggtcgccggatcgttccccgagatcgtcgaggccgtggcggcc
gcggtcggcccgcaccgggtggtcctcgacggggagatcatcgcccccgaaggcgcccgg
ggcgcgccgtcgttctcccggttgcagcgccgcatgcacgtgcgcgccccgacaccgcag
ctcatccgcgaggtgccggtgttgtacatgctgttcgatctgctcgcgctcgacgggcac
gccaccgtgcgtctgccctacaccgagcgccgcgacctgctcgcccggctcgacatcgcg
cgcccgccgttgcagctgtcgccgagctggaccgatgtcgaccccgccgagctggccgcg
gccgccaccgacaacggcctggaagggctggtcgccaaacggctcgattcggtgtatcag
cccggggagcgcagccgcgcctggctcaagatgccgttccgcagaacgaccgaagcggtg
atcgccggatggttgccgggtaacggtccgttccagaagtcgttcgggtcactggttctc
ggtgcacacgatgcacaggggcggctggtgcacatcggcaacgtcggcaccggatggaag
cagtccgagcgcacccggttacggcagcggctcgacgaaatcgcccgcccggactcaccg
ttcgacgtgcccgcgccccgcccggtcgccgcgctcgcccactgggtctcccccgaactc
gtcgccgacatcgagtaccgcgaagccaccgccgaaggactgcgccacccgagctggcgc
gggctgcgcatcgacaaggacccggccgagatcacctggcccgcctga

DBGET integrated database retrieval system