KEGG   Nocardia farcinica NCTC11134: ERS450000_01322Help
Entry
ERS450000_01322   CDS       T04524                                 

Gene name
gabD_2
Definition
(GenBank) Succinate-semialdehyde dehydrogenase [NADP(+)] GabD
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00250  Alanine, aspartate and glutamate metabolism
nfr00310  Lysine degradation
nfr00350  Tyrosine metabolism
nfr00650  Butanoate metabolism
nfr00760  Nicotinate and nicotinamide metabolism
nfr01100  Metabolic pathways
nfr01120  Microbial metabolism in diverse environments
Module
nfr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ERS450000_01322 (gabD_2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ERS450000_01322 (gabD_2)
   00310 Lysine degradation
    ERS450000_01322 (gabD_2)
   00350 Tyrosine metabolism
    ERS450000_01322 (gabD_2)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ERS450000_01322 (gabD_2)
Enzymes [BR:nfr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     ERS450000_01322 (gabD_2)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     ERS450000_01322 (gabD_2)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     ERS450000_01322 (gabD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 DUF3102
Motif
Other DBs
NCBI-ProteinID: CRY75423
UniProt: A0A0H5NIS2
LinkDB All DBs
Position
1:1328253..1329716
Genome map
AA seq 487 aa AA seqDB search
MTDREGALLATAPHQLFIGGEWVDATGGATFAVHDPATGEIVREVADATAEDAVRALDAA
VAAQESWAATAPRTRSEILRRAWELVQERAEDLALLMTLEMGKPLAEARGEVTYGGEFLR
WFSEEAVRIHGRYGLNPEGTGQMIVSQRPVGPCYFITPWNFPFAMATRKIAPALAAGCTV
VVKPPQLTPLTTLFFTGLLAEAGLPAGVVNVVTSTSSRRVSAPIIADSRLRKLSFTGSTE
VGRQLIAQAADNVLRVSMELGGNAPFVVFEDADLDKAVEGALAAKFRNIGQACTAANRFI
VHEQVAEEFAARVTERVAAMKIGRGTEDGVTIGPLIDDDAVAKAHELVTDATARGAVVRT
GGERIDGPGSFYRPTVLTGVTEGSAILREEIFGPVLAIATFTTEDEAVRLANNTEYGLVS
YVYTRDLARGHRMIDKLETGMMGLNAGVVSNAAAPFGGVKQSGVGREGGFEGIHEFLSTK
YTLIPAS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcgcgagggcgcgctgcttgccaccgcgccgcaccaattgttcatcggcggc
gaatgggtcgacgccaccggcggcgccaccttcgcggtgcacgatcccgccaccggcgag
atcgtgcgcgaggtcgccgacgccaccgcagaggacgccgtgcgcgccctcgacgccgcc
gtcgccgcccaggagtcgtgggcggccaccgctccgcgcactcgcagcgagatcctgcgc
cgcgcctgggaactcgtgcaggagcgggccgaggacctggcgctgctgatgaccctggag
atgggcaagccgctggccgaggcgcgcggtgaggtcacctacggtggcgagttcctgcgc
tggttcagcgaagaggcggtgcgcatccacggccgctacgggctcaatcccgagggcacc
gggcagatgatcgtctcccagcgcccggtcgggccctgctacttcatcacgccctggaac
ttcccgttcgcgatggcgacccgcaagatcgcccccgccctggccgcgggctgcacggtg
gtggtgaagccaccccagctcaccccgctgaccaccctgttcttcaccggtctgctcgcc
gaggccgggctgcccgcgggcgtggtgaacgtggtgacatccacgtcctcgcggcgggtg
tcggcgccgatcatcgccgactcccggctgcgcaaactctccttcaccggctcgacggag
gtcggcaggcagctcatcgcccaggccgccgacaacgtgctgcgggtgtcgatggagctc
ggcggcaacgcgccgttcgtggtgttcgaggacgccgacctggacaaggccgtcgagggc
gcgctggcggccaagttccgcaacatcggccaggcctgcacggccgccaaccggttcatc
gtgcacgaacaggtggccgaggagttcgccgcgcgggtcaccgaacgggtcgcggccatg
aagatcggccgcggcaccgaggacggcgtcaccatcggtccgctcatcgatgacgacgcc
gtcgccaaggcccacgaattggtcaccgacgccaccgcccgcggcgcggtggtgcgcacc
ggcggcgaacggatcgacggcccgggcagcttctaccggcccaccgtgctcaccggcgtc
accgagggcagtgcgatcctgcgcgaggagatcttcggcccggtgctggccatcgccacc
ttcaccaccgaggacgaggcggtgcgcctggccaacaacaccgaatacggcctggtgtcc
tacgtctacacccgggacctggcccgcggccaccgcatgatcgacaagctcgagaccggc
atgatgggcctcaacgccggcgtcgtctccaacgccgccgcccccttcggcggcgtcaaa
cagtccggcgtcggccgcgagggcggcttcgagggcattcacgaattcctctccacgaaa
tacacgctgatccccgccagctag

DBGET integrated database retrieval system