KEGG   Nocardia farcinica NCTC11134: ERS450000_01619Help
Entry
ERS450000_01619   CDS       T04524                                 

Definition
(GenBank) Acyl-CoA dehydrogenase%2C short-chain specific
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00071  Fatty acid degradation
nfr00410  beta-Alanine metabolism
nfr00592  alpha-Linolenic acid metabolism
nfr00640  Propanoate metabolism
nfr01040  Biosynthesis of unsaturated fatty acids
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01200  Carbon metabolism
nfr01212  Fatty acid metabolism
Module
nfr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ERS450000_01619
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ERS450000_01619
   00592 alpha-Linolenic acid metabolism
    ERS450000_01619
   01040 Biosynthesis of unsaturated fatty acids
    ERS450000_01619
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ERS450000_01619
Enzymes [BR:nfr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     ERS450000_01619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: CRY75980
UniProt: A0A0H5NJ37
LinkDB All DBs
Position
1:complement(1630185..1632116)
Genome map
AA seq 643 aa AA seqDB search
MATGSPTTADHLRAALDGPWRDIRQQARRELADERFLGDPNLDYKAARARVLDQMRLLAA
MDYAKRGFRLENGGVGDPGGAVTALEMVAYADLSLWVKSGVQWGLFGGAVENLGTERHRE
YIKQLISLDLLGCFAMTESGHGSDVASLETTATYDPATQEFVIHSPTPSARKDYIGGAAE
HARMAAVFAQLITQGEGRGVHCFLVPIRDEQGADLPGVTTSDDGLKGGLLGVDNGRIVFD
HVRIPRENLLNRYADVEPDGTYSSPIENPSRRFFTTLGTLVRGRISVGGAAAAGARVALS
IAVRYALQRRQFADPDSGTETVLMDYRMHQRRLLPLVAKSFAYAFAQNDLVRRMHVIQTG
QNLDPGAQRALEKRAAGLKVAQTRHATRAIQECREACGGAGYLTENRLVTLKADTDVFTT
FEGDNVVLTQLVAKELLTAYADEVQDLDALGWVRFAATMAGDVVRKRSGVRQLIQTLRDR
SDESVDEGDLSRRSTQLQLFADREDYLVRTAAHRLRARAEDTTPFEGFNNAQDHILAAGS
AHIDRLVLEAFIEGIGEIEDPEARALAETVCDLFVYTLLEENSAWYIMHRFMSVERAKAV
RRGVNELVDRLRPHALTLVEAMGVPEEMLHAAMLHDASVYQRS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccggcagcccgacgacggcagatcacctccgagcagcactcgacggaccctgg
cgtgacatccggcagcaagcccgccgcgaactcgccgacgagcgctttctcggggacccg
aacctcgactacaaggccgcgcgggcgcgggtgctcgaccagatgcgcctgctcgccgcg
atggattacgccaagcgcggtttccgtctggagaacggcggcgtcggcgaccccggcggc
gcggtgacggcactggagatggtcgcctacgccgacctgtcgctgtgggtgaaatccggc
gtgcagtggggcctgttcggcggggcggtggagaacctgggcaccgagcgccatcgcgag
tacatcaagcagctgatctcgctggacctgctcggctgcttcgcgatgaccgagtcgggc
cacggcagcgacgtcgccagcctggagaccaccgccacctacgatccggcgacccaggag
ttcgtgatccactcgccgacgccctcggcccgcaaggactacatcggcggcgcggccgag
cacgcccggatggcggcggtgttcgcgcagctgatcacgcagggtgaaggccgcggcgtg
cactgcttcctggtgcccatccgggacgagcagggcgccgacctgcccggcgtcaccacc
tccgacgacggcctcaagggcgggctgctcggcgtcgacaacggccgcatcgtcttcgac
cacgtccggattccgcgggagaacctgctcaaccgctacgccgacgtcgagcccgacggc
acctacagctcacccatcgagaacccgagcaggcgcttcttcaccacgctcggcacgctg
gtgcgcggccggatcagtgtgggcggcgcggccgccgcgggcgcgcgggtcgcgctcagc
atcgccgtccgctacgcgctgcagcgccgccagttcgccgaccccgacagcgggacggag
acggtgctcatggactaccggatgcaccagcgcaggctgctgccgctggtcgccaagtcc
ttcgcctacgccttcgcgcagaacgacctggtgcgccggatgcacgtcatccagaccggc
cagaacctcgaccccggcgcccagcgggccttggagaagcgggccgcgggtctcaaggtc
gcccagacccggcacgccacccgcgccatccaggaatgccgggaggcgtgcggcggcgcc
ggctacctcaccgagaaccggctggtcacgctcaaggccgacaccgacgtgttcaccacc
ttcgagggcgacaacgtcgtgctcacccagctggtcgccaaggaactgctcaccgcctac
gccgacgaggtccaggatctcgacgcgctgggctgggtgcgtttcgcggccaccatggcc
ggtgacgtggtgcgcaagcgctcgggcgtgcgccagctgatccagaccctgcgcgatcgc
agcgacgagtcggtcgacgagggcgacctgtcgcgccgctccacccagttgcagctgttc
gccgaccgcgaggactatctcgtccgcaccgccgcccaccggctgcgcgcccgggccgag
gacaccacgccgttcgagggcttcaacaacgcccaggaccacatcctggcggccgggtcc
gcgcacatcgaccggctggtgctggaagccttcatcgagggcatcggcgagatcgaggac
cccgaggccagggcgctggccgagaccgtgtgcgacctgttcgtctacacgctgctcgag
gagaactcggcctggtacatcatgcaccgcttcatgtccgtcgagcgggcgaaggcggtg
cggcgcggggtcaacgagctggtcgaccggctgcgcccgcacgcactcaccctcgtcgag
gcgatgggcgtgccggaggagatgctgcacgcggcgatgctgcacgacgccagcgtgtac
cagcggagctga

DBGET integrated database retrieval system