KEGG   Nocardia farcinica NCTC11134: ERS450000_03235Help
Entry
ERS450000_03235   CDS       T04524                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00473  D-Alanine metabolism
nfr01100  Metabolic pathways
nfr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nfr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ERS450000_03235 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ERS450000_03235 (alr)
Enzymes [BR:nfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ERS450000_03235 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:nfr01011]
 Precursor biosynthesis
  Racemase
   ERS450000_03235 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CRY78971
UniProt: A0A0H5P8Q7
LinkDB All DBs
Position
1:complement(3337401..3338528)
Genome map
AA seq 375 aa AA seqDB search
MSAQVEAVVDLDAIAHNVRVLREYAGDAAMMVVVKADGYNHGAVEVARTALAAGARELGV
TTVAEALRLREAGITAPVLCWLNTLSADYAAAVAADIEIGVSGTEQLRAVATAARATGRT
ATVTLKVDTGLNRNGIAADELPTVLDLLGELVEEKTVRLRAMFSHLAHADEPKHPFLDEQ
RDRFTAAAAAATARGLRPELLHLANSAATVTRPDLAFDMVRPGIAVYGLSPVPELGDFGL
RPAMTFQAQVALVKRVAEGEGVSYGHQWIAPRDTTVALIPAGYADGVFRPLSGRFDVWLG
GARRPNVGRVCMDQFVVDLGDDAAGVAAGDTAVLFGGGPGVPGAQEWADLLGTIHYEVVC
SPRGRAVRRYVGTGR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcccaagtggaggccgtggtcgacctcgatgcgattgcccataatgtgcgggtc
ctgcgtgagtacgcgggcgatgcggcgatgatggtcgtcgtcaaggcggacggctacaac
cacggggcggtggaggtggcgcgcacggcgctggcggcgggggcgcgggaactgggcgtg
accaccgtggccgaggcgctgcgactgcgcgaggcggggatcacggcaccggtgctgtgc
tggctgaacaccctgtccgccgattacgccgccgcggtcgccgccgacatcgagatcggc
gtctccggcaccgagcagctgcgcgccgtcgccaccgcggcccgcgccaccggccgcacc
gccaccgtgacgctcaaggtcgacaccggactcaaccgcaacggcatcgccgccgacgag
ctgccgaccgtgctcgacctgctcggtgagctggtcgaggagaagacggtgcgattgcgc
gcgatgttctcccacctggcccacgccgacgagcccaaacacccgttcctcgacgaacag
cgcgaccgcttcaccgccgcggccgccgcggccaccgcccgcgggctgcgtcccgaactg
ctgcacctggccaactccgccgccaccgtgacccggcccgacctggccttcgacatggtg
cggcccggcatcgccgtctacggcctgagccccgtgcccgaactcggcgatttcgggctg
cggcccgccatgaccttccaagcgcaggtcgcgctggtcaaacgcgtcgccgagggcgag
ggcgtctcctacggccaccagtggatcgctccccgtgacaccaccgtcgcgctgataccc
gccgggtatgccgacggcgtgttccggccgctcagcggccgcttcgacgtgtggctcggc
ggtgcccgccgccccaacgtcggccgggtctgcatggaccagttcgtcgtcgacctcggc
gacgacgccgcgggcgtggcggcgggcgacaccgccgtgctgttcggcggtgggcccggc
gtgccgggtgcccaggagtgggccgacctgctcggcaccatccactacgaggtggtctgc
tcgccgcgtggccgggccgtccgccggtacgtcggaacgggccgctga

DBGET integrated database retrieval system