KEGG   Nocardia farcinica NCTC11134: ERS450000_03443Help
Entry
ERS450000_03443   CDS       T04524                                 

Definition
(GenBank) sensory histidine kinase CreC
Organism
nfr  Nocardia farcinica NCTC11134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: CRY79323
UniProt: A0A0H5NVL6
LinkDB All DBs
Position
1:complement(3621841..3625635)
Genome map
AA seq 1264 aa AA seqDB search
MRDAARSGKKRWALGNWDLRWKVTAVLAVPLAVAVGLGVSRITSEFTEANRLEGVAENIE
AIPAVTGLSAAAATVAGSQMVSLMPGASVVTDQDLSQLDQAITTAQDAGAKLRGHSKAEA
SLETMITEARAILARGKAAAQPTDALGGIDRIRNESVSIVESTVSQVSDPAMDAAKLRLV
DSLNTRATLVAELAAFNEVLHDFKAGVQTFTTASETERQLLNVLAHRFPDGDSAIADLRA
GVDTRLSLINSPEAQAGRLPLGELKNSLTTSVDVYERVVAKATKDIDSAMDNLAGRANRD
AWTYTAVVIATILAALLLAVFVARSMIVPLHRLRLAALRVAESDLPHEVAQLRNGASPED
VPLEPMPIRSTEEIGQLARAIDDIHGQALRLASDQAQMRSQVNDMFETLARRSKSLVDHQ
LSLIEAMEYDEKDPRLLENLFRLDHLAARMRRNGDNLLILAGTKQRRAKSAPVEIGDVLR
AAISEVEDYERVKLGATPRGALKEPAASDLAHLFAELLDNALRASPPETDVKFTFAQAHD
QGLLIEVADRGIGMPPAEMAEINRKLEQTAEPGPDTARHMGLFVVGRLAERHGLTVRLRP
TFDTARDPGVTVTVHVPVGLIVPAGQASGPQAVVKAAPVQPNPQHPTPSMQTRAITRTSA
GNMMVTVDPGVSGPIQTGSGPLTPPAPAPTGPGGLPQRQPGSAMAGGLRQEGSASLRESS
AAAQANGPQRGKLAAASLPKRNLATGGPAAAQRPSVTPPATPGTARPSVTPPATPGTAGP
AGTTPGGLPQREPGANGVPQPGAGGGLPQRQPGASGAPQPEAGGLPQRQPGGNGAPAPTA
GGLPHREPGANGAPEPDAARGSAATGLPQRESGPARPGGNGLPQRQPGATPGLPQREPGA
TGMHREGGAAGLPPREGGPSGLPQREAGPNGLPQRGAPAGGLPPRDGGPSGLPQREAGPN
GLPQRGAAPGGLPQREEGAAGLAPRDGGAPGLPQREGGATGLPPRDNGATGLPQRAPGAP
AAGEGGPNSTGLPQRGANGLPQRGGLPQRDSGLPERESGANGLPQRAPEPSRPAPGTGLP
QRDPGARHQPLGEVPPGVGLAQRDSGTEAGDGASESAPARDPGKHSYKSNPAKTASFFQT
RLQPAVEPGSSMDSPIFAEMMSAWLADPNPDRSQVAASFESPGDEGWQAARRASEAQAEK
KTAAGLPQRDPGGRLVPGAVSGAADRAPRRDPESIRSSLSRHQKGVRDGRAMRAMNLTGD
KGDR
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgccgcaaggtccggcaagaagcgctgggcgctcggcaattgggacctgcgc
tggaaggttacggccgttctcgccgtgccgctggctgtcgcggtgggtctcggcgtgtcg
aggatcacctcggagttcaccgaggccaaccgcctcgagggcgtggccgagaacatcgag
gccattccggctgtcaccggcctgagcgcggccgcggccaccgtcgccggttcgcagatg
gtgtcgctgatgccgggcgcgtcggtggtgaccgaccaggacctcagccagctcgaccag
gccatcaccacggcccaggacgccggcgccaagctgcgcgggcacagcaaggccgaggcg
tcgctggagaccatgatcaccgaggccagggccatcctggccaggggtaaggccgcggcg
cagcccaccgacgcactgggcgggatcgaccggatccgcaacgagagcgtcagcatcgtc
gagagcacggtgtcgcaggtcagcgacccggccatggacgcggccaagctgcgcctggtc
gactcgctcaacacccgcgccacgctggtcgccgagctggccgccttcaacgaggtgctg
cacgacttcaaggccggtgtgcagaccttcaccaccgcctcggaaaccgagcgtcagttg
ctcaacgtcctcgcgcaccgcttccccgacggtgactccgccatcgccgacctgcgcgcc
ggcgtggacacccggctctcgctcatcaacagccccgaggcccaggcgggcaggctgccg
ctcggcgagctgaagaactccctcaccaccagcgtcgacgtctacgaacgcgtggtcgcc
aaggccaccaaggacatcgacagcgcgatggacaacctggcgggccgggccaaccgcgac
gcctggacctacaccgccgtcgtcatcgcgaccatcctggccgcgctgctgcttgccgtg
ttcgtggcgcgctcgatgatcgtgccgctgcaccggctgcgcctggccgccctgcgcgtc
gccgagagcgacctgccgcacgaggtcgcgcagctgcgcaacggcgcctccccggaggac
gtgccgctggagccgatgccgatccgcagcaccgaggagatcggccagctggcccgcgcc
atcgacgacatccacggccaggcgctgcgcctggcctccgatcaggcgcagatgcgctcc
caggtcaacgacatgttcgagacgctggcgcgccgctccaagtcgctggtcgaccatcag
ctcagcctcatcgaggcgatggagtacgacgagaaggacccccgcctgctggagaacctc
ttccggctggaccacctcgccgcccgcatgcgccgcaacggcgacaacctgctcatcctg
gcgggcaccaaacagcgccgcgccaagtcggcgccggtcgagatcggcgacgtgctgcgc
gcggccatctccgaggtcgaggactacgagcgcgtcaagctgggcgccaccccgcgcggt
gcgctcaaggagccagcggcctccgacctggcccacctgttcgccgagctgctggacaac
gcgctgcgcgcctcgccgcccgagacggacgtgaagttcaccttcgcgcaggcgcacgac
cagggtctgctcatcgaggtcgccgaccggggcatcggcatgccgcccgcggagatggcc
gagatcaaccgcaagctcgagcagaccgccgagcccggtccggacaccgcccgccacatg
ggcctgttcgtcgtcggccggctggccgagcggcacggtctgaccgtgcggctgcgcccg
accttcgacaccgcgcgcgatccgggtgtcacggtgaccgtgcacgtcccggtcggcctg
atcgtgcccgccggccaggcctccggtccgcaggcggtcgtcaaggccgcgccggtgcag
ccgaacccgcagcatccgaccccgtccatgcagacgcgcgcgatcacccgcacgtcggcg
ggcaacatgatggtcaccgtcgacccgggtgtcagcggtcccatccagaccggctccggt
ccgctcactccgcccgcacccgcgcccaccggccccggcggcctgccgcagcgtcagccg
ggttcggcgatggcgggcgggctgcgccaggagggttcggcgagcctgcgcgagtcgagc
gccgcggcccaggcgaacgggccgcagcgcggcaagctcgccgccgccagcctgcccaag
cgcaatctcgccaccggcggtccggccgccgcgcaacggccatcggtcacgccgcccgcg
acgcccggcacggcacggccgtccgtcacgccgcccgcgacgcccggcacggccggcccc
gcgggcaccacacccggcggtctgccgcagcgtgagcccggcgccaacggggtgccgcag
cccggcgcgggcggtggcctgccgcagcgtcagccgggtgccagcggtgcgccgcagccc
gaggcgggcggcctgccgcagcgtcagccgggcggtaacggtgcgcccgcgcccaccgcg
ggtggcctgccgcaccgcgagcccggcgccaacggcgccccggagcccgacgccgcccgc
gggtccgccgccaccggtctgccccagcgggaatccggtccggcgcgtccgggcggcaac
ggcctgccgcagcgtcagccgggtgccaccccgggcctgccgcagcgggagccgggcgct
accggcatgcaccgcgagggcggggccgcgggtctcccgccgcgtgagggcggcccctcc
ggtctgccgcagcgtgaggcgggtccgaacggcttgccgcagcgcggtgccccggcgggc
ggtctcccgccgcgcgacggcggcccctccggtctgccgcagcgtgaagcgggcccgaac
ggcctgccgcagcgcggtgccgcgccgggtggtctcccgcagcgcgaggagggggccgcc
ggtctggccccgcgtgacggcggcgcgcccggcctgccgcaacgcgagggtggcgccacc
ggtctgccgccgcgggacaacggtgccaccggcctgccgcagcgcgcgcccggtgctccg
gccgcgggcgagggcgggccgaactcgaccggtctgccccagcggggcgccaacgggctc
ccgcagcgtggcggtctaccccagcgggacagcggcctacccgagcgcgagagcggcgcc
aacgggctcccgcagcgcgcgcccgaaccgagccgtcccgcgcccggtaccggtctgccg
caacgtgatccgggtgcgcggcatcagccgctcggcgaggtgccgcccggagtgggtctc
gcacagcgcgattccggcaccgaggccggtgacggtgcgtccgaatccgcccccgcgcgc
gatcccggcaagcacagctacaagtccaaccccgccaagaccgcgtcgttcttccagacc
cggttgcagcccgcggtcgagccggggtcgtcgatggacagcccgatcttcgccgagatg
atgtcggcgtggctggccgatccgaacccggaccggtcccaggtcgcggcctccttcgag
tcccccggtgacgaaggctggcaggcggcgcggcgcgcgagtgaggcccaagccgagaaa
aagaccgctgcgggcttgccgcaacgcgatccgggcgggaggctagtccccggcgccgtg
agcggcgccgcggatcgggcacctcgccgtgatccggaatcgatcaggtccagcttgagt
cgtcaccagaagggcgtccgggatggccgcgcaatgagagcaatgaacctaaccggagac
aaaggagaccgatga

DBGET integrated database retrieval system