KEGG   Nocardia farcinica NCTC11134: ERS450000_04384Help
Entry
ERS450000_04384   CDS       T04524                                 

Definition
(GenBank) Putative aldehyde dehydrogenase SA1924
Organism
nfr  Nocardia farcinica NCTC11134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CRY81378
UniProt: A0A0H5P1G6
LinkDB All DBs
Position
p2:complement(926368..927813)
Genome map
AA seq 481 aa AA seqDB search
MHYDSLFIGGRWTEPAGSERLQVISPATVEPVGSVPVVERADVDAAVTAARHAFDHGPWP
STPPTERAAVLTKAARLIEQRSGDLVAALTAEMGAPGMAAMTLNQLPATATLDTYAALAQ
TFPWTETRTGSFGTTRVSREPRGVVAAVTAWNVPLFLAVNKLAPALLAGCTVVLKPAPLT
PLTANMIADIFTEAGVPEGVISVLPAEAEVAEYLIAHPGVDKVTFTGSTPVGRRIAAIAG
EQLKSVSLELGGKSAAILLEDMDVAANIPVLAFSGLMNSGQGCVAQTRILAPRSRYDEIL
DALVEHVRTLKTGDPNDPSVTFGPLISERQRERVEGYIAKGKAEGARLVLGGGRPAGLDR
GWFVEPTIFADVDNKSTIAQEEIFGPVLSVIPYETEDEAVAIANDSAYGLAGSVWTTDVE
HGAAIAARVRTGTYAINWYAFDPTAPFGGYKNSGLGRENGPEGLDSFCEQKSLLMPMGWT
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcattacgacagcttgttcatcggcggccgctggaccgaaccggccggctccgagcgc
cttcaggtcatctcgcctgccacggtagagccggtgggcagcgtcccggtcgtggaacgc
gccgacgtcgacgcggcggtcacggccgcccggcatgccttcgatcacggcccgtggccg
tccaccccgcccaccgagcgcgcggcggtgctgaccaaggccgcccgcctgatcgagcag
cgctccggcgatctggtcgccgccctcaccgcggagatgggcgcgcccggcatggccgcg
atgaccctcaaccagctcccggccacggccactctcgacacctacgccgcactggcgcag
acgttcccgtggaccgagacccgcaccggttccttcggcaccacccgggtcagccgcgaa
ccgcgcggcgtggtggcggccgtgacggcctggaacgtgccgctgttcctggcggtcaac
aagctcgcccccgccctgctcgccgggtgcacggtggtgctcaagcccgcaccgctgacc
ccgctgacggccaacatgatcgccgacatcttcaccgaggcgggcgtgccggagggcgtc
atctcggtactgcccgccgaggccgaggtcgccgagtacctgatcgcccaccccggcgtc
gacaaggtcaccttcaccggcagcacgccggtcggccgccgcatcgccgccatcgccggg
gaacagctcaagagcgtctccctcgaactgggcggcaagtccgccgcgatcctgctcgag
gacatggacgtggccgccaacatcccggtactcgccttctccgggctgatgaacagcggg
cagggctgcgtcgcgcagaccaggatcctggcgccgcgcagccggtacgacgagatcctc
gacgcgctggtcgagcacgtgcgcacgctgaagaccggcgacccgaacgatccgtcggtg
accttcggcccgctgatctccgagcgccagcgtgagcgggtggagggctacatcgccaag
ggcaaggccgagggcgcgcggctggtgctcggcggcggcaggcccgcggggctcgaccgc
ggctggttcgtggagccgaccatcttcgccgacgtcgacaacaagtcgaccatcgcgcag
gaggagatcttcggcccggtgctctcggtgatcccctacgagaccgaggacgaggccgtg
gccatcgccaacgactccgcctacggcctggccggttcggtgtggaccaccgacgtcgag
cacggcgccgccatcgccgcgcgggtgcgcaccggcacctacgcgatcaactggtacgcc
ttcgacccgacggcgccgttcggcggctacaagaactcggggctgggacgcgagaacggg
cccgagggtctcgactcgttctgcgagcagaagtcgctgctgatgccgatgggctggacc
ggctag

DBGET integrated database retrieval system