KEGG   Nocardia farcinica NCTC11134: ERS450000_04440Help
Entry
ERS450000_04440   CDS       T04524                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
nfr  Nocardia farcinica NCTC11134
Pathway
nfr00220  Arginine biosynthesis
nfr00250  Alanine, aspartate and glutamate metabolism
nfr00290  Valine, leucine and isoleucine biosynthesis
nfr01100  Metabolic pathways
nfr01110  Biosynthesis of secondary metabolites
nfr01130  Biosynthesis of antibiotics
nfr01210  2-Oxocarboxylic acid metabolism
nfr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ERS450000_04440
   00290 Valine, leucine and isoleucine biosynthesis
    ERS450000_04440
   00220 Arginine biosynthesis
    ERS450000_04440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nfr01007]
    ERS450000_04440
Enzymes [BR:nfr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ERS450000_04440
    2.6.1.66  valine---pyruvate transaminase
     ERS450000_04440
Amino acid related enzymes [BR:nfr01007]
 Aminotransferase (transaminase)
  Class I
   ERS450000_04440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CRY81485
UniProt: A0A0H5P0P7
LinkDB All DBs
Position
p2:985304..986557
Genome map
AA seq 417 aa AA seqDB search
MGHVSPHLPHRPPRVLEQSTKLQNVVYEIRGPVHAHAARLEAEGHRILKLNIGNPAPFGF
EAPDVIMRDIIAALPYAQGYSESKGILSARRAIVTRYELVPGFPEFDVDDVYLGNGVSEL
ITLTMQALLDNGDEVLIPAPDYPLWTAMTSLAGGTPVHYLCDESNGWQPDIADIEAKITD
KTKALLVINPNNPTGAVYSAEVLQQIVDLARKHQLLLLADEIYDKILYDDAKHISLATLA
PDLLCLTFNGLSKAYRVAGYRSGWMVITGPKEHATGFLEGIDLLATSRLCPNVPAQHAIQ
VALGGHQSIEDLILPGGRLLEQRDVAWERLNMIPGVSCVKPKGALYAFPRLDPEVYEIHD
DSKLILDLLLQEKILMVQGTGFNWPAHDHLRIVTLPWARDLAVAIERFGNFLASYRQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggacacgtgagtcctcatcttccgcatcgcccgccgcgcgttctggagcagtccacg
aagctccagaacgtcgtctacgaaattcgtggaccggtacacgcgcacgcggcacggctg
gaggcggaggggcatcgcatcctcaaactcaacatcggcaatcccgcgccgttcggcttc
gaggcgcccgatgtgatcatgcgcgacatcatcgccgcgctgccgtatgcgcagggctac
tcggagtccaagggcatcctgtcggcgcggcgggccatcgtcacccgctacgagctggtg
ccgggtttccccgagttcgacgtcgacgacgtctacctcggtaacggcgtctccgagctg
atcacgctcaccatgcaggcgctgctcgacaacggtgacgaggtgctcatccccgcgccg
gactatccgctgtggaccgcgatgaccagcctcgccggtggcacgcccgtgcactacctg
tgcgacgagtccaacggctggcagcccgacatcgccgacatcgaagccaagatcaccgac
aagaccaaggccctgctggtgatcaacccgaacaacccgaccggggcggtgtactcggcg
gaggtgttgcagcagatcgtcgacctcgcccgtaagcatcagctgctgctgctggccgac
gagatctacgacaagatcctctacgacgacgccaagcacatctcgctggccacgctggcc
cccgacctgctgtgcctgaccttcaacgggctgtccaaggcctaccgggtggcgggctac
cgctccggctggatggtcatcaccggtccgaaggagcacgcgacggggttcctggagggc
atcgacctgctcgccacctcccggctgtgcccgaatgtgcccgcgcagcacgcgattcag
gtcgcgctcggcggccatcagagcatcgaggacctgatcctgcccggcggccggttgctg
gagcagcgtgatgtcgcgtgggagcggctgaacatgattcccggtgtgtcctgtgtgaag
cccaagggcgcgctctacgccttcccgcggctggaccccgaggtctacgagatccacgac
gactcgaagctgatcctggatctgctgctgcaggagaagatcctgatggtgcagggcacc
gggttcaactggcccgcccacgatcacctgcgcatcgtgacgctgccctgggcgcgcgat
ctggcggtggcgatcgaacggttcggcaacttcctggccagctatcggcagtga

DBGET integrated database retrieval system