KEGG   Nocardia farcinica NCTC11134: ERS450000_05668Help
Entry
ERS450000_05668   CDS       T04524                                 

Definition
(GenBank) Uncharacterised protein
Organism
nfr  Nocardia farcinica NCTC11134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: CRY83756
UniProt: A0A0H5PMN4
LinkDB All DBs
Position
p2:2342777..2343679
Genome map
AA seq 300 aa AA seqDB search
MCRDMSADRSGRTGKALVAAALAILALTSCTIDTGDDAQAAEPPVATTTSTPADQQRIEI
TLPGTLAADFQQWKAGLRGRAGLAVMPVGGERMVTFGDWTSGPAWSTMKIPLVIAAERAD
AGASTYAMSAAVTASDNAAADTLWQGLGGGKQAAEAVEAVLREAGDSTTAVPPTRVRAEH
SAFGQAEWSLAEQVRFASRLPCLSGADTVLNLMAQIVPSHRWGLGTVGGAEFKGGWGPDT
SGDYLVRQFGIIDGPGGRIAVALAAQPESGAFSDGMTALNAMAALITDHLDELAGGSCPS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgagatatgtctgctgatcggtccgggcggactgggaaggcgctggtcgcggcc
gcgctggcgatactggcgctgacctcctgcacgatcgataccggcgacgatgcccaggcc
gccgaaccgccggtggcgaccacgacgtccacccccgccgatcagcaacgcatcgagatc
accctgcccggcacgctggccgcggacttccagcagtggaaggccggactgcgcgggcgc
gcgggactggccgtcatgccggtcggcggcgaacggatggtgaccttcggcgactggacc
agcggcccggcctggtcgacgatgaagatcccgttggtgatcgcggccgaacgcgccgac
gcgggcgcgtccacctatgcgatgtcggcggcggtcaccgcgtccgacaacgccgccgcc
gacaccctgtggcagggcctcggcggtggcaagcaggcggccgaggcggtggaggcggtg
ctgcgggaagcgggcgacagcaccaccgcggtgccacccacccgggtacgggccgagcat
tccgccttcgggcaggccgagtggtcgctggccgagcaggtgcgcttcgcctcccggctg
ccgtgcctgtccggggcggacaccgtgctgaacctgatggcccagatcgtgcccagccac
cgctggggcctcggcacggtcggcggcgccgagttcaagggtggctgggggccggacacc
tcgggcgactaccttgtccggcagttcggcatcatcgacggccccggcgggcggatcgcg
gtggcgctggccgcccagcccgaatcgggcgccttcagcgacgggatgaccgcgctgaac
gccatggccgcgctgatcaccgaccatctcgacgaactcgcgggtggcagctgcccgtcc
tga

DBGET integrated database retrieval system