KEGG   Nocardia farcinica NCTC11134: ERS450000_05894Help
Entry
ERS450000_05894   CDS       T04524                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
nfr  Nocardia farcinica NCTC11134
Brite
KEGG Orthology (KO) [BR:nfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nfr03016]
    ERS450000_05894 (truB)
Enzymes [BR:nfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     ERS450000_05894 (truB)
Transfer RNA biogenesis [BR:nfr03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    ERS450000_05894 (truB)
 Prokaryotic type
    ERS450000_05894 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2
Motif
Other DBs
NCBI-ProteinID: CRY84178
UniProt: A0A0H5P9S5
LinkDB All DBs
Position
p2:2567829..2568749
Genome map
AA seq 306 aa AA seqDB search
MGERSAPTRRVDPLGGLLVVDKDGGMTSHDVVARCRKILGTRKIGHAGTLDPMATGVLVL
GVERATKLLGLLTLTTKAYTATIRLGSATTTDDAEGEVLTTVPAGHLGDAEIAAGVTALT
GDIQQVPATVSAIKIGGERAYARHRAGEQVALAARPVTVSRFEILARRDVAGFVDLDVVV
ECSSGTYVRALARDLGAALGVGGHLTALRRTRVGPFTLDHARTLDALADEPRLNLDMDEA
VRIAFPHREIDTREAESLRDGRWLDPVGIPGVYAALTADGTAIALLEEKGKRASPVFVVR
PRGLVD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcgcagcgcaccgacgcgccgcgtcgacccgctcggcgggctgctcgtcgtc
gacaaggacggcggcatgaccagccacgacgtcgtcgcgcgctgccggaagatcctgggc
accaggaagatcgggcacgcgggcaccctcgacccgatggccaccggcgtgctggtgctc
ggcgtggagcgggccaccaagctgctcgggctgctcaccctcaccaccaaggcctacacc
gcgaccatccgcctcggcagtgccaccaccaccgacgacgccgagggcgaggtgctcacc
accgtccccgcgggccacctcggcgacgccgagatcgccgcgggggtgacggcgctgacc
ggcgacatccagcaggtgcccgccaccgtcagcgcgatcaagatcggcggcgagcgcgcg
tacgcccgccaccgcgcgggggagcaggtcgcgttggccgcgcggccggtgacggtgtcg
cgcttcgagatcctggctcgccgcgacgtcgccggattcgtcgacctcgacgtggtggtg
gagtgctcctcgggtacctacgtgcgggcgctggcccgagatctgggtgcggcgctcggt
gtcggcggccacctgacggcgctgcgccgcacccgggtgggcccgttcaccctcgaccac
gcccgcacgctcgacgcgctcgccgacgagcctcggctgaacctcgacatggacgaggcc
gtgcgaatcgccttcccgcaccgggagatcgacacccgcgaggcggagtcgctgcgcgac
ggccgctggctcgacccggtcggcatccccggtgtgtacgccgccctgaccgccgacggc
accgccatcgcgctgctcgaggagaagggcaagcgcgcctcgccggtgttcgtggtgcgc
ccgcgcggactggtggactga

DBGET integrated database retrieval system