KEGG   Nothobranchius furzeri (turquoise killifish): 107372442Help
Entry
107372442         CDS       T05163                                 

Gene name
kmt2b
Definition
(RefSeq) histone-lysine N-methyltransferase 2B
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107372442 (kmt2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107372442 (kmt2b)
   03036 Chromosome and associated proteins [BR:nfu03036]
    107372442 (kmt2b)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107372442 (kmt2b)
Transcription factors [BR:nfu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    107372442 (kmt2b)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107372442 (kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     107372442 (kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2
Motif
Other DBs
NCBI-GeneID: 107372442
NCBI-ProteinID: XP_015796175
LinkDB All DBs
Position
Unknown
AA seq 3783 aa AA seqDB search
MMAAAGCGSATAAAVGGQSGTATARGRFPGRPWSSRSRLRSEKRWQLGRSNSEADDVTTV
GPRPANLAVSLNEDQSHLRLLGIEASHKILGQAGYSSSGSEEGDDFKGFESDRKRLQEPT
MSHQNSSKGDVLKTKSKRRIEKLPQKTPAKDAAIPPVPVKAVEDNAAVDAKPAKDLKKNL
KGKNTMDRQSTKSRAPAAAPRITIKLVAKKKTVNEPQKRSVKTLKTKEAQDRPDVKDIQD
DQILSAHIKVKTETFVEEQGSEDKGARSIPTRRRGRSAMKEAEPVSQTTAKVVVGDQKSK
EKEVADTGKDIEPVEPKPRAKEVKKKAAAPQVSAAKQVTRRSNRVTNPASKKATGGVSET
DSSNKTTPALTVPKSELSDIVEAKPPAARERRRQSKRLNKDVSVPENCGSSSPEPDKLDT
KNKESLPFTNEEERVPSLKLIKIKNPKYDPQNHGKTSARKKKRRKYIWTLTLVKGRIQPP
GPENTTKVPAETVDQPAPCDTSVNKNTKGQGRRSKPESAAPKESVAVTRNDLQNEPASEN
SSLQAEVETPTQETIKTDSGKVVPPLQIKKVSSPGKKHKSSKPSFLIQQVSPEKKEDVQK
DPAEAHEEKPSSPDGEAAPTRTLRRRTPSVDSANTRSVSQKPAATHKRILRKIQEKGTPQ
VEVPPQVSTEDPTSQALPTNSCQILPDPPQDASLNSLDVLEKDTLEVNDGSSQSAGEVCP
LKVEKEAEPQTEEIKPLPVPSKPRKPRNNKLVKKKKKAMVSPDATVDTAPVAIDSTAAEP
VQTEDVQPLVVEVSQPEVKEVTQQDEAPETKQDPTSVEEEQKESPVKEEPHMQLIDTPPS
EVPESLANKPKTFKKSHKKLKKTRKSLTGPRPKHRHRDRDGKFAPLTLSESQSVDEVDDN
YSHATPASYLGSKLIGVQKKYKKKRKGFHFMGSKRPKSTSKIISTLMEMGLGQGSLKQEE
ADTPVDSGQTSVANPQPGKSKFVKNIKHFIMPVVSARSSRVIKTPQRFMDDAGMSVLPRR
NSPKKGLQLGLQVRSGKRQDDEAERAISPIFPINEEDILNEAQLDVDLFSAQDLDDDLDL
ADSLFCDRKSNKNEMKEPFLKNSSFKWHLSEEPDEGVYTLDTSPVGKCENLFLSVDKPPE
PSSDLMDFLRKKSSPKFNKQAAQLKIYQRLKKPHTGLPKSKATQELEPASKPAAPPVDLA
EGLDDEVMSISLRQRDTSTEKAKSKLKIEDLDSPGVVRKVSVCVRGTNSIALQQRGGEAL
AGNTVLASGEPKPAQNSGASRGVHVGSVEKGAPQRARLTGANKRMLNLLRKAKVQLIKID
QQKQLKSSGLLSGPAGARSQDLTSKRQRRKQRLRRYPDVPVKTEPLQGQPQLISPLCQEF
RRAGGPRIKHVCRAASVVLGQPRALVPDDIPRLSALPLHERSGISPSAVTQDVGSQSEPD
SPGLSDSKATKSKKTSNFAKRKGLGPFGYRSRRCGVCKGCNHEDDCGDCINCLDKPKFGG
PNTKRQCCVYKRCDQIEERKARRLSGRTVPKGSNKRRRPSLSVGHSSNDEGMEGAGDSPS
GLQTDGHSPSVRKQPKRVVKPRVYFDLVDYDSDLDEKALCNSASPARRRGAGPRFGQDFV
SLDGFWEDFSDDEVRHRKSSSHRVPQGRRKPEKVLSSQSPLEQTPPSVLAALAHGFEQRD
VESSKPTHKIRVDFKEDCTPENVWNLGGLSVLTSAPLMPPYVCFLCASKGQHEMLYCQVC
CEPFHRFCLEPAERPSEENKENWCCRRCKFCHVCGRKNKLSRPLMECERCQNCYHASCLG
PNYPKQPKKRKTWVCMTCIRCKSCGVTPGKTWDTDWNHSKGLCPDCSKLYDQGNYCPICF
KCYEDNDYDSQMMQCGTCNHWVHARCEDLTDELYEILSSLPESVVYSCRPCSVTQPSAWR
ELLYIELRAGVEKVLACLLSSTLTQHLVTCSQCETLVDPDGGTEGQPACDLRAVGKKFDK
GLYTSLKKFHEDVVQVVRRKLELEEHLPEEQRPTALARSYYLKLLEEVFNWFNGQDPKLW
TLSTKDLPMGMLSHAVHPPNTEHVYAQWQERRQLLSRPPLGLLLEDNGQSLDIKEEEAVS
PMSGDPTSRNHFRTSRTLRIKGKRGRLSKADLDTGWTKEDERQCSLCQKYGDLKPNEAGR
LLYLGQNEWAHVNCCLWSAEVFEEDNGSLLHVHSAVTRGRLMRCERCNHTGATVGCCLTS
CQSNYHFMCARSRQCVFQDDKKVYCYKHRHLISGRMTTGQEFEVNRRVYVDFEGISLRRK
FLTGVEPDLINLMIGSLQIDKLGVLTEISALKGKLFPVGFQCSRWYWSTVNPLRRCRYTC
TIREVRPVIPEKPAEEMPDRGENHTIAHSPFQPELEAQDTDVSESQPPAEEGFVTGLPSK
SDHFARPKVSSHPLPRRPAGGMSRPLPCPGIAETKPHHILTVSDLEETRRARRHSPHSQT
SGLRSRMSPPPLAPLAGSATLRSSKPSLPTSPLYPLSDHSVNCPSSRSVGSRNASKARCP
GNTLTHCTPSFFPQSHWQDSVASVSLPFSSSMQHLPRNRLSFDLSQSDSVEVPHNFLASP
EPEDISPTNGTSPHVDMDKHGEEFPYNSFNRDSSISLGEEMRAELEIEETLLNEGVAMNC
GGQIVVEGDDQEEYWGRTQEVHKKKSLVASLPRSAASNKEDLGNTSSDDDVEHYFDFSRT
IVSCPISKDRSKSPCSSSSRPLAQLDGIDDGTESDASVVTTDDPQKVGGFCKNPIQSRNP
NSTEALGSSDNKQAESSSVAMAASNKCPLSSSNVDKNSSVGQKPATSPADRLPDLLTKVP
ESSHPLVGSSLGFATGTPLVLQECDSGPRFTELLPVLQGTPLPSETCKTLNSDPNIFAAS
TEGSAVVINHLTPDVIEPSLQCSVDGTQGSLLGLLEPSPLMPADDARNPSQCLDDSLDMF
SCLPGFSQSPQTSITLQPVTAVQELAGYPSTEPFSSKLTTLTPVEDVSQMQLNVANQTNP
GLPAILGACPPPETCAIVSVPMYSTQTQPFSSASLTIVSSSASVSTPCAATSAPLQTTSA
PMILNGYGSSLLQKEATSGHTISINFSAPRPAMEPQQPVLPQALPGHAILTVKEVGGPNV
DPTPHVLLVNRLGQIFVKNPESNTFQLPTPNSPSYNCVTQIASLLQSNALSATLAAAGNL
TTAPLGANMAAVPASVSPAVQSPSTVTQLLTNNTNGAMASSHVKKSKKNTKAPKEETIPE
MKKPKKKKESSSSKKAKSSMVTGQTVVLSENPPVSPAESAQAIINQAMASNYTPKWTGLR
TMSPSSLVLPPGLLIEPEPPVVPRSPSPTPAPAPRPRSHVRMKRVSSLSDRIITKKSKVD
FLPPEVVSEEEEEEEQQLRKPAFPSISSRASGVRIKTPTVKGILNLDELKEEHMSDSESS
GSEPWNYLSQGEQGKQPAWEPVGHNNLTDWKKYSGAASTTDDETSSFEDDEVCPTNKEQP
HLRFEITSDDGFSVEADSIEVAWKAVIHGVQEARAIARLRPLTFQKITGAQMLGLVHDAV
VYLLEQLEGANRCQRHSFRFFKQFSQEDDLPVNPSGCARSELYVRKSTFDMFNFLASQHR
QLPDISPYDDEEDEVLLKSTRRATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGLFCK
RNIEAGEMVIEYAGIVIRAVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFIN
HSCEPNCYSRVINVEGRKHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGARRCRR
FLN
NT seq 11352 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcagcgggatgcggatcagcaaccgcggctgccgtaggaggccagagtgga
accgctacagccagaggtcgtttccccggtcggccttggtcttcgcgcagtcgtttgcgt
tctgaaaagcgttggcagctcggacgatcaaactcagaagctgatgatgtgactaccgta
gggccaaggcccgcaaacctggctgtttcgttaaacgaagaccagtctcacttgcgccta
cttggaatagaggcaagccacaagatccttggccaggctggatatagctctagtgggagt
gaggagggtgatgatttcaaaggatttgaatctgacagaaaacgtttgcaagaacccacg
atgtctcaccaaaattcttccaaaggtgatgttctcaagacaaaatctaaacgaagaatt
gagaagctgccacagaaaaccccagcaaaagatgcagctatcccacctgttcctgttaaa
gctgtggaggacaacgcagccgtggacgcaaagccagcaaaggatttgaagaaaaatttg
aaaggaaaaaacactatggaccggcagtccactaaaagcagagctcctgcagcggcgccg
aggattacgataaagttagtggccaaaaagaaaacggtaaacgagcctcagaaaagatca
gtgaagacgctgaagacgaaagaagcgcaggaccgacccgacgttaaagacattcaggac
gaccagattttaagcgcacacattaaagtaaaaaccgaaacatttgtggaggaacaaggc
tccgaggataaaggagcaagaagcatacctacaaggaggcgtgggagatctgccatgaag
gaagcagaacctgtaagccagactactgccaaagttgtggttggtgaccaaaaatcaaaa
gagaaagaagtggctgacacgggaaaggacatcgagcccgtggagcccaaaccgagagca
aaggaagtaaagaagaaagcagcggcacctcaggtttctgccgctaaacaagtaactcgt
cggagcaacagagttactaacccagcctctaaaaaggccacgggcggtgtgtctgaaact
gacagctccaataaaaccactcctgctctgactgtgcccaagtcagagctttcagacatt
gtcgaggctaaacctccagctgctagagaacgacgacggcaaagcaaaaggttaaataaa
gatgtttcagtgccagaaaattgcggctcatcatctccagagcccgataagttagacaca
aaaaacaaggagagtttaccctttacaaatgaggaagagagggtcccaagcctaaagtta
ataaaaatcaaaaatcccaaatacgatccgcagaaccacgggaagacttcggctcggaag
aaaaagcgaagaaaatatatttggactttgacattagtgaagggaagaattcaaccacct
gggcctgaaaacacgaccaaagtaccagcagagacggtggatcagcctgctccatgtgac
accagcgtcaacaagaacacaaaaggacagggtagaagatccaaaccagagagcgcagcc
cccaaggagagcgtggcagtcaccaggaatgatctccaaaacgagcctgcctcggaaaac
tctagtttacaagctgaagttgaaacacctacgcaagaaaccattaagaccgacagtggg
aaggttgtaccgcctcttcagatcaagaaggtttcttctcctgggaagaagcataaaagc
tcaaagccgtcatttttaatccagcaggttagccctgaaaagaaggaggacgttcagaaa
gatccagctgaagctcacgaagagaagccatcttctccagatggcgaggctgctcctact
aggacattaaggagaaggacgcctagtgttgattcagcaaacaccagatctgtcagccag
aagccagcggccactcacaaacgaatattacgaaaaatccaagagaaagggactccacag
gtagaagttccccctcaggtctcaactgaagatcccacctctcaagctcttcccacaaac
tcttgccaaattttgccagatccaccacaagatgccagcctgaactcgttggacgttctt
gagaaggatactttagaggttaatgacggttcttcacagtcggcaggggaagtttgtcca
ctgaaggtggagaaagaggcagaaccacagactgaagagatcaaaccactacctgtgcct
tccaaacctaggaaacctagaaataataaactagtcaaaaagaagaaaaaggccatggtt
tcaccagatgccactgtagacacggctcctgttgcaatcgactcgactgctgcagaacct
gtccaaacagaagatgtgcaacccttagttgtagaggtcagtcagcctgaggtgaaagag
gtcacacagcaggacgaagcaccagagaccaaacaggaccctacgtcagtggaagaggag
cagaaagagtcgccggtgaaggaagaaccacacatgcagctgatcgacactccgccttca
gaggtgccggaaagtctcgcaaataagccaaaaactttcaaaaaatctcacaagaaacta
aagaagacacgcaaaagcttaactggaccacgtcccaaacacaggcacagagacagagat
gggaaatttgctccacttacattatccgaaagtcaaagtgtcgatgaggtggatgataat
tactcccatgcaacccctgcttcatacctgggctctaaactcatcggagtacagaaaaag
tacaaaaagaagcggaaaggatttcattttatgggatccaaaaggcctaaatcaacatcg
aaaatcatctctacactgatggaaatggggttaggacagggaagtttaaagcaggaagaa
gcagacaccccagtcgactcgggacaaacgagtgttgctaacccccagcctggaaagtcc
aagtttgtaaaaaacatcaaacacttcattatgcccgttgtaagcgctagatcttcccgt
gtcatcaagaccccgcagagattcatggatgatgctggaatgtcggtgttgcctcgcaga
aactctcccaagaagggtttgcagctgggcctgcaggtacgctccggaaagaggcaagac
gacgaagcagaaagagccatctcccccatctttcctatcaacgaggaggacatccttaat
gaagctcagctggatgttgatctgttttcagctcaggacctggatgatgaccttgaccta
gctgatagcctgttttgtgacagaaaatccaacaagaatgaaatgaaggagcccttttta
aagaactccagcttcaagtggcatctttcagaggagcccgacgagggggtgtacacactg
gacacaagcccagtgggcaaatgtgagaatctgtttttatccgtggataaaccgccagaa
ccttcgtcagaccttatggactttctgagaaagaaaagttcgcccaagtttaacaagcaa
gcagctcaactcaagatttaccagagattaaagaagccgcacacgggacttcctaagagc
aaagccacgcaggagctcgagcctgcgagcaaacctgccgcgcctccggtggatttagca
gaaggactggatgacgaggtgatgagcatcagtttgagacaacgggacacgagcacagaa
aaggccaagtctaagctgaagatagaggaccttgattctccaggggtagtgaggaaggtt
tctgtgtgtgtccgggggaccaactccatcgcacttcaacaacgtggaggagaagcttta
gcaggaaacaccgtcctagcctcaggagagccgaagcctgcacagaactcgggcgcaagc
agaggtgttcatgtaggttctgtggagaaaggagctccacagcgagctcgcctcactggt
gcaaacaaaagaatgttgaatctcctgaggaaagccaaggttcagctcattaaaatcgac
cagcagaaacagctgaagtcctctgggcttttatcgggtccagccggagccaggtctcaa
gatctcacctcaaagagacagaggaggaagcagaggctgcggcgttatcctgatgttcca
gtcaagaccgagcctcttcaaggacaaccgcagctcatttccccactctgtcaggagttc
cgcagagcaggaggtccacgaatcaagcacgtgtgccgcgctgcctccgtggtgctgggg
cagcctcgggccctcgttcctgatgacattcccagactaagcgccttgccgctgcatgag
agatccggcatttccccatcagctgtcactcaagatgttgggtctcagtcggagccggac
agcccaggactttcagattcaaaggcaacaaaatcaaagaagacatcgaattttgcgaag
aggaaaggactcggcccgtttgggtaccgctcacggaggtgtggcgtgtgcaagggctgc
aaccacgaggacgactgtggcgactgcataaactgcctggacaaacccaagtttggcggt
ccaaacaccaagcgtcagtgttgcgtctataagagatgtgatcaaattgaagagagaaaa
gctcgcagacttagtgggaggacggtacccaaaggatccaataagcgtaggcggccatct
ctcagcgtgggtcactcgagtaacgacgaagggatggagggtgccggcgactcgccatct
ggcctccagaccgacggccacagtccatcagtgaggaagcagccaaagcgtgtggtgaaa
cctcgcgtgtatttcgacctggtggattatgactcggatctggacgagaaagctttgtgc
aactcggcctcaccggcgaggagacgtggtgccggacctcgtttcggccaagattttgtg
tctctggatgggttctgggaagacttttcagacgatgaagtcaggcatcgcaaatctagt
tcacatcgggtaccgcagggtcggcggaaacccgagaaggttctgtcgtctcagagtcct
ttggagcagaccccccccagcgtccttgctgctctggctcatggctttgagcagcgagac
gtggagtcttctaaaccgactcacaaaatcagggtcgacttcaaggaggactgtactcca
gagaacgtgtggaacctgggtggtttaagcgtgttgacctctgcgccgctcatgcctccc
tacgtttgcttcctttgtgccagtaaaggccaacacgagatgttatactgccaagtatgc
tgcgaacccttccaccggttctgccttgaacctgctgaacgtccctcggaggagaataag
gaaaattggtgctgcaggcgctgcaaattctgtcatgtgtgtgggagaaaaaacaagctc
tccaggcctctaatggagtgtgaacggtgccaaaactgttaccatgcttcctgtctggga
ccaaactatccaaaacaacccaagaagaggaaaacctgggtgtgtatgacatgcatcagg
tgtaaaagctgtggtgtcactccggggaagacttgggacaccgactggaaccacagtaaa
ggcctctgtccagactgttcaaaactctacgaccagggaaattactgtccaatctgcttc
aagtgctatgaagataacgactatgatagtcagatgatgcagtgtggcacgtgcaaccac
tgggtgcatgcccgatgcgaggatctaacagacgagctgtatgagatcctgtccagcctg
ccagagagcgtggtctattcgtgccggccgtgcagcgtgacccagccaagcgcctggagg
gagctgctttacatcgagctcagggccggggtggagaaggtgctggcgtgcttactgtcc
tccaccctcacccagcatcttgttacctgctcacagtgtgagacgttggttgaccccgat
ggtggaactgaaggtcagccagcctgtgaccttcgagcagtcggcaagaagttcgacaaa
ggcctgtatacgtcactgaaaaagttccatgaagatgtggtccaggtggtgcgaaggaag
ctggagctggaagagcacctcccagaggagcagaggcctactgccctagcacgctcttac
tacttaaagctcctggaggaggtgtttaactggttcaacggtcaggacccaaagttgtgg
accctttctaccaaagacttgcccatggggatgctgtcccacgctgttcatcctcccaac
accgagcacgtttacgcccagtggcaggagaggaggcagcttctgtccaggcctccgctg
ggtctcctgctagaggacaacggacagagcttggacataaaggaggaggaggcggtttct
ccgatgtcgggcgatccgacaagccgtaatcatttcagaactagcagaactctcagaatc
aaaggtaaaagaggcagactttccaaagcagatctggacacaggatggactaaagaggat
gaaaggcagtgctctctgtgccagaaatacggagacctgaaacccaacgaggcggggcgc
ctgctgtacctgggccagaacgagtgggcacatgtcaactgctgcctgtggtcggcggag
gtgttcgaggaggacaacggctctctgctgcatgtgcacagtgctgtcacaagggggcgc
ttgatgcgatgtgaacgctgtaatcacaccggtgccaccgtgggctgctgtttgacatct
tgtcaaagtaactaccacttcatgtgcgcccgctctcggcagtgtgtgttccaggatgac
aaaaaggtctattgctacaaacatcggcatctcatcagtggcaggatgacaacaggtcag
gagtttgaagtaaaccgcagagtgtatgtggactttgaagggatcagccttcgcaggaag
ttcctgactggcgtggagcccgacctgattaacttgatgatcggatccttgcagatcgac
aagttgggagtgttaactgaaatttctgctttaaagggcaaattgtttcctgtgggtttt
cagtgttctcggtggtactggagcacagttaatccgctgaggcggtgcagatacacgtgt
acaatccgggaagttcgacccgttattccagagaagcctgcggaggagatgcccgaccga
ggcgagaatcacaccattgctcacagcccctttcagcctgaattggaagcccaagacacg
gatgtgtcagaaagccaacccccagcagaagaaggctttgtcacaggtcttccctccaag
tcggatcacttcgcaaggcctaaagtttccagccatcctctgcccagaaggcccgctgga
ggaatgtcccgccctctgccgtgtccaggcatagccgagacgaaaccccaccacattctg
actgtaagcgatttagaagagactcggagagctcgtcgccacagcccacactcccagaca
tcaggacttcgcagtcggatgtccccacccccactggctcctctagccggatcagctacc
cttcgttctagcaaaccttccctgcctacttccccactatatcccctttcagaccactct
gtgaactgcccgtcgtcccgctctgtaggaagtcgaaacgcctccaaagcccgttgccct
ggcaacacgttaacacactgcactccgtcgttctttcctcagtctcactggcaggacagt
gtagcctctgtaagtctgcctttctcgtcatccatgcaacatttacctagaaatcgcttg
tcgtttgatctgagtcagtccgattctgttgaggtgccacacaacttcttggcttcgccc
gaacctgaagatatctccccaacgaatggcacatcacctcatgtggacatggacaaacac
ggtgaggagtttccatacaactcattcaacagggattcctctataagtctgggcgaagag
atgcgagcagaacttgagattgaagaaacgctcctgaatgagggggtggctatgaactgc
gggggccagatagtggtggaaggtgatgatcaggaggagtactgggggagaacccaggag
gtacataaaaagaaatcccttgttgcgagccttcctcggtctgcagcctcaaacaaggaa
gacttgggaaacacttcctctgatgacgacgtggagcactattttgatttctcacgaaca
atagttagctgcccaatatcaaaagatcggtccaagtccccttgctcatcttcctcgcgg
cccttggctcagttggatggtatagatgacggtacagagagcgatgcaagtgtagtaact
actgatgatcctcagaaggtcggtgggttctgcaaaaatccgattcaaagcagaaaccca
aacagcacagaggcccttggttcatcagacaacaagcaggcagagtcttcatctgttgcc
atggctgcttccaataaatgtccactttcgtccagcaatgtcgacaagaactcttcagta
ggtcagaaacctgcaacttcccctgctgaccgtcttccagatttactcacaaaggtgcct
gagtcgtcacatccattggtcggttccagtttaggctttgccacaggaacacctcttgtt
cttcaggaatgcgacagtggcccgcgtttcacagaactgcttcctgtgctacaaggcact
cctctcccgtctgaaacatgcaaaaccctgaactctgaccccaacatctttgcagcatca
actgagggatctgctgttgtgataaaccacttaacacctgatgtgatagaaccgtcatta
caatgttcagttgatggtacccagggctctctgctgggcctgcttgagccttcaccttta
atgcctgcggatgatgcacgaaacccctctcaatgccttgacgattctctcgatatgttt
tcttgtttaccaggcttcagtcagtctcctcaaacgagtatcacacttcagccggtgacg
gctgtgcaggaattggcaggctacccatccaccgagcctttctccagtaagctaacgacc
ctcactccagtggaagatgtgtcgcagatgcagctaaatgttgcaaatcaaaccaatcca
gggttaccagcaatcctgggggcttgccccccacctgaaacgtgtgccattgtttcggtt
cccatgtactccacacaaacacagccgttcagttctgcatcactcaccatcgtttcttct
tcagcttcggtatcgacgccctgtgcggccacgtcagcaccgttacaaaccacctccgcc
cctatgatcctaaacgggtatggctcctcgttactgcagaaggaagccacatctggtcat
acaatttccatcaacttctctgcaccgaggccagctatggagcctcagcagcctgtgctg
ccccaggcgttacccggtcacgctatcctcactgtgaaggaggtaggaggtccaaacgtg
gaccctacaccacatgttctactggtgaaccgccttgggcagatctttgtgaagaaccct
gaaagcaacactttccagctgcccactccaaactccccctcgtataactgtgttacccag
attgccagtcttctacagagtaacgcactttcggccactctggcagcagctggtaatctg
accactgcgccgttaggggccaacatggctgcagttcctgcatcagtcagtcctgcagtt
cagagtccaagtacagtcacacagctgctcaccaacaacaccaatggtgccatggcatca
tctcatgtgaaaaagtccaagaagaacacgaaagcaccaaaagaggaaacaatccccgag
atgaaaaaaccaaagaagaagaaggaatccagttcatccaagaaagcaaagtcctccatg
gtgacgggacagactgtcgtgttatcagagaatcctcccgtgtctcctgctgagagcgcc
caagcaattattaaccaagcaatggctagcaactacacccccaaatggaccgggctacgg
actatgagtccttcttctctggttctgccaccaggccttttgattgaaccagaacctccg
gtggtgccacgttctccttcaccgacaccagcccccgcacctcgacctcgcagccacgtc
cgcatgaaaagagtgtcttccctttcagatcgcatcatcaccaagaagtctaaagttgac
ttcctgcctccagaagtcgtcagtgaggaggaggaggaggaggagcagcagcttcggaaa
cctgctttcccgagcatctccagcagggcctcgggagttcgcatcaaaactccaaccgtg
aaaggaatcctaaacctggatgagctgaaggaggagcacatgagtgattcagagagctct
ggatcggagccttggaattacttatctcagggcgagcaaggcaaacagcctgcatgggaa
ccagtgggacacaacaacctgaccgactggaagaaatactctggcgctgcttctacaact
gacgatgagacatcatcatttgaggatgatgaagtatgtccaactaacaaagagcagcca
cacttgaggttcgagatcaccagcgatgatggtttcagtgtagaggcagacagcatcgag
gtggcttggaaagcggtgatacacggcgtgcaggaggcacgagccatagcgaggcttcgg
ccgctgacctttcagaagatcacgggcgcccagatgcttggactggttcacgatgctgtt
gtgtatttactggaacaacttgaaggggctaatcgctgccagaggcattctttccgtttc
ttcaagcagttcagccaggaagacgatctccctgtgaatcccagtggttgtgctcgatct
gagctctatgtgaggaagtctacatttgatatgttcaactttctggcttctcagcacaga
cagcttcctgatatcagcccgtatgatgatgaggaagatgaagttcttttgaagtccaca
agacgagccaccagcttggagctgcctatggccatgcgtttcagacacctggagaggacg
tctaaggaggctgtgggggtgtacaggtctgccattcatgggcgcggtctgttttgtaag
aggaacatcgaagctggagagatggtcattgagtacgccggcatcgtcattcgagcagtg
ctcactgataaaagggaaaaatactacgacggaaagggtatcggctgttacatgttccgc
atcgatgactttgacgtggtggatgcgaccatgcacggcaacgcagctagattcatcaac
cactcgtgcgaacccaactgctactcgcgggtgatcaacgtggaaggtcggaagcacatc
gtcatcttcgctctcaggaagatctacagaggggaggagctcacctacgactacaagttc
ccaattgaagatgccagcaacaaactgggctgcaactgcggggcccggcgttgtcggcga
ttcctcaactga

DBGET integrated database retrieval system