KEGG   Nothobranchius furzeri (turquoise killifish): 107372514Help
Entry
107372514         CDS       T05163                                 

Definition
(RefSeq) trypsin-3-like
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 107372514
NCBI-ProteinID: XP_015796226
LinkDB All DBs
Position
Unknown
AA seq 245 aa AA seqDB search
MKYLILLALLAAAYAAPIEDDKIVGGYECRKNSVPYIASLNAGYHFCGGSLISSTWVVSA
AHCYKSRIQVRLGEHNIAVSEGTEQFIDSAMVIRHPSYNSYNLDNDIMLIKLNKPASLNN
YAKTVSLPSSCASAGTNCLISGWGNTSSSGSYYPDNLRCLDAPILSDSSCRNSYPGQITS
NMFCAGFLDGGKDSCQGDSGGPVVCGSQLQGIVSWGYGCAQRNKPGVYTKVCNFTTWIRN
TMSSN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttgatcctcttggctctgctggctgcagcttatgctgctcccattgaggat
gacaagatcgttggaggctacgagtgcaggaagaactctgtgccctacattgcctctctg
aacgctggctaccacttctgtggaggctctctgatctccagcacctgggtggtgtctgct
gctcactgctacaagtctcgtatccaggtgagactcggtgagcacaacattgccgtgagc
gagggcacagagcagttcatcgattctgccatggtcatccgtcatcccagctacaacagc
tacaacctggacaatgacatcatgctgatcaagctgaacaagcccgcctctctgaacaac
tacgccaaaaccgtgtccctgccctccagctgcgccagcgctggcaccaactgtctgatc
tctggctggggcaacaccagcagcagtggaagctactatcctgacaacctgaggtgtctg
gatgctcccatcctgagtgacagcagctgcaggaactcctaccctggacagatcacctct
aacatgttctgtgctggattcctggatggaggcaaggactcctgccagggtgactctgga
ggcccagtggtgtgcggcagtcagctgcagggtattgtgtcctggggttatggctgcgcc
cagaggaacaagccaggagtctacaccaaggtctgcaacttcaccacctggatccgcaac
accatgtcctccaactaa

DBGET integrated database retrieval system