KEGG   Nothobranchius furzeri (turquoise killifish): 107374241Help
Entry
107374241         CDS       T05163                                 

Definition
(RefSeq) paired box protein Pax-8-like
  KO
K09293  paired box protein 8
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107374241
Transcription factors [BR:nfu03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    107374241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 107374241
NCBI-ProteinID: XP_015797878
LinkDB All DBs
Position
sgr02
AA seq 462 aa AA seqDB search
MSGNTGRGHGGLNQLGGMFVNGRPLPEVIRQRIVDMAHQGVRPCDISRQLRVSHGCVSKI
LGRYYETGSIKPGVIGGSKPKVATPKVVEKIADYKRQNPTMFAWEIRDRLLAEGVCDSDT
VPSVSSINRIIRTKVQQPFNLPLDGKGLSPGQTLIPSSAVTPPESPHSDSLGSTYTINGL
LGIPQPNTEGKRSHDDSDQESCRHSVDSQASSGVPRKQMRLDHFSAASQHLDCGFDRHHY
PSDSFSSASSSKTEQTLYPLSLINGSLEEAKNSLSTSGSVIGRNLSAHQGYAVVTEPLQT
LPLCLKQEISPEVTNTSPSPNMAASNLAIVELQKPVSVSSSCNSSNSNHHFPNAFNSFSH
HAPVYGQFSSQAIISGRDMVSSTLPGYPPHIPSPAQTGYSSSAITGMVAAGADYSGQSYT
HSPYTSYSEAWRFTNSSILGSPYYYSSASRTGPPSTAAYDHL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaacactgggagaggtcatgggggtcttaaccaactaggcggaatgtttgtt
aatggccgtcctcttccggaggtgatccggcagcgcatcgtggacatggcccaccagggg
gtccggccctgcgacatctcccggcaactccgggtcagccacggctgcgtcagcaagatc
ctgggacgctactacgagacaggcagcatcaaaccgggagtgatcggtggctccaagccc
aaggtggccaccccaaaagtggtggagaagattgcagattacaagaggcagaatcccacc
atgtttgcgtgggaaatcagagaccggctgctggcggagggcgtgtgtgacagtgacaca
gtgcctagcgtgagctccattaacagaataattcgaactaaagtccagcagccgtttaac
cttcccctggatggaaaaggcctgagcccagggcaaacattaatacccagctcagccgtc
acccctcctgagtctccacattcagactcgctgggctccacctacaccatcaacggcttg
ttgggcatcccccagccaaacaccgagggcaagaggagccatgatgacagtgatcaggag
agctgtcggcacagtgtggactcccaggccagcagcggcgtaccgagaaagcagatgagg
ctggaccacttttccgcagcgtcgcaacatctggactgtgggttcgatcgccaccactat
ccatcagactcattcagttctgcctcaagcagcaagacggaacagactttgtacccactg
tccctaatcaacgggagcctagaggaggccaagaacagcctctcaacatctggctccgtc
atcggacggaacctgtcggcacaccagggctatgccgtggtcaccgagcccttacagacc
ctgccgctctgcctgaaacaggaaatatccccagaggtcaccaacacgagcccctcgccc
aacatggcggcctctaacctggccatagtggagctgcagaaacccgtttctgtcagcagc
agctgcaacagcagcaacagtaaccatcacttccccaatgccttcaactcattctcccat
catgcaccagtgtatggccagttcagcagccaggctatcatctcaggccgtgacatggtg
agctccaccctgccgggctacccgccccacatcccatccccagcccagacagggtactcc
tcctctgccatcacaggcatggtagcagcaggtgcagactactcgggtcagtcctacacc
cattccccctacacctcctacagcgaagcctggaggttcactaactcaagcatactgggt
tctccctactactacagctctgcctcccgcacaggccccccctccacagctgcctacgac
cacctctag

DBGET integrated database retrieval system