KEGG   Nothobranchius furzeri (turquoise killifish): 107374449
Entry
107374449         CDS       T05163                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04068  FoxO signaling pathway
nfu04110  Cell cycle
nfu04115  p53 signaling pathway
nfu04218  Cellular senescence
nfu04310  Wnt signaling pathway
nfu04340  Hedgehog signaling pathway
nfu04371  Apelin signaling pathway
nfu04510  Focal adhesion
nfu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107374449 (ccnd1)
   04340 Hedgehog signaling pathway
    107374449 (ccnd1)
   04371 Apelin signaling pathway
    107374449 (ccnd1)
   04068 FoxO signaling pathway
    107374449 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107374449 (ccnd1)
   04115 p53 signaling pathway
    107374449 (ccnd1)
   04218 Cellular senescence
    107374449 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107374449 (ccnd1)
   04530 Tight junction
    107374449 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C PX CdiI_2
Other DBs
NCBI-GeneID: 107374449
NCBI-ProteinID: XP_015798085
UniProt: A0A1A8UBG6
LinkDB
Position
Unknown
AA seq 292 aa
MDEQLLCCEVDSIRRAYQDVNLLNDRVLRTMLRAEENYLPAPNYFKCVQKEIAPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVESSRKSRLQLLGAACMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIHLSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKNQDAALSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSGTTENKHVEEEVDPSSTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggatgagcagctgctgtgctgcgaagtggactccatccggagagcctaccaggacgtg
aacctgttgaatgaccgggtcctccgaaccatgctgcgggccgaggagaactacctgccg
gctccgaactacttcaagtgcgtccaaaaggaaatagctcctaaaatgaggaagatccta
gcgacctggatgctggaggtgtgtgaggagcagaagtgtgaggaggaggtctttcctctg
gccatgaactacctggaccggttcctgtccgtggagtccagcaggaagagccgcctgcaa
ctgctgggagccgcgtgcatgttcctggcgtccaagatgaaggagacggttccgttaacg
gcggagaagctctgcatctacacggacaactcggtccagcccggagagctgctgcagatg
gagctgttggttctgaacaagctgaagtgggacctggcttcagtcacgcctcatgacttc
atcgagcacttcctgtccaaactgaagatccatttgtccacaaagcagatcctcaggaaa
cacgcccagaccttcgtggctctctgtgctacagacgtgaacttcatagccagccctccg
tcgatggtggcagccggcagcgtggtggcagccgttcagggcctctacctgaagaaccag
gatgccgccctgtcctctcagaacctcaccaacttcttgtcccaggtcatccgcagcgac
ccggactgcttgcggtcgtgtcaggagcagatcgagtccctgctggagtccagcctgcga
caggctcagcagcacagcggcacaacggaaaacaaacatgtggaggaggaggtggacccg
tcctccacgcccacagacgtgagagacatcaacatctga

DBGET integrated database retrieval system