KEGG   Nothobranchius furzeri (turquoise killifish): 107374472Help
Entry
107374472         CDS       T05163                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00052  Galactose metabolism
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107374472
   00500 Starch and sucrose metabolism
    107374472
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107374472
    3.2.1.20  alpha-glucosidase
     107374472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107374472
NCBI-ProteinID: XP_015798108
LinkDB All DBs
Position
Unknown
AA seq 1825 aa AA seqDB search
MGLKRWSRLELILIGLFLLMTVAAITMIIVFVTEEPGVIKDEFPSGAFVPKCPSISLDQR
IDCFPDAGASKMKCEQRGCCWSPLDERNVPWCFFSTNQGYTVEHLEHPNPFVINVQLKRM
AAPSLFGADIEQLTFHAEMQTKNRLRFKIFDAKNRRFEVPHVHIRTVSSNPSSPITNTLD
IAHNPFGLTVRRKENRRALFDTTIGPLVFADQYLQLSAKLPSHNIFGLGEHVHTRYRHDT
NWRTWPIFTRDTQPNGRANNLYGHHPFFLCLEDESGKSFGVFLLNSNAMEVTLQPAPAVT
YRTIGGIFDFYIFFGDTPEQVVQEYLELIGRPVIPPYWSMGFQLSRWNYGNLSEVKRVVE
RNRAVGLPYDIQYTDIDYMEHMKDFTYDPVRFKELPEFAEYLHEKGQKYILILDPAIATS
RRVGGAPYESYDRGMEKNVWVTKSDGRTPIVGRVWPGETVFPDFTSETCIDWWVDEYERF
YREIKHDALWIDMNEVSNFLKGSTTGCEDNKLNYPPYTPKILNELLYSMTLCMDAKQEWG
DNYDVHSLYGYSMVLATEKALQHVFGPNRTMMLTRSSFPGVGKYSGHWLGDNTATWNDIK
WAIHGMLEFGLFGIPYIGADICGFFGDSSEELCRRWMQVGAFYPFSRNHNAMNFKPQDPA
AFGADSVLVKTSKHYLRIRYTLLPYLYTLFYKAHTTGETVVRPVLHEFYSDRATWDVDLQ
FLWGKHLLITPVLDPGVDTIRVYIPDAVWYDYETMERLTDRRKHVDMYLPADKLGLHIRG
GAVLPTQRPEVTTTHSRSNPMGLVIALDDNNQAAGELFWDDGDSRDTVNNGNYIHYKFSV
IYGVLTMQVTKAGYKDPNNLKFENITVLGVPHPPTSVSVTHVNTGSHLGATTVLPNTNIY
HDGAKEVLFLHGLSLTLGETYLVRWDMEDEELQRFNCHPEENADEAKCKSRGCIWKPSST
ERVPWCFYPKDYGYVVTAATETDSGIMVDITRNVKHRISARPDSPDINNLRVEIRYHTSD
LLQFKIWDPTSDRFEVPVPLSTPDAPETDENKRLYKVLISNKPFGIQVIRRSTGTKIWDS
SVPGFTFSDMFIQVSTRLPSKFIYGFGETEHPTFKHDLNYHTWGMFSKDQPPGYKMNCYG
VHPFYMGLEDTADAHGVLLLNSNAMDVTFQPTPALTFRTVGGILDFYMVLGPTPEMVVQE
YTALIGRPVLPAYWSLGFQLCRYGYANDSEIKSLYKDMRAAGIPYDVQYADIDYMERQLD
FVLDSEFAGLPAVVDSMRNEGMRFIFILDPAISGNETRYPAFERGQAADVFIKWPKHLKD
DIVWGKVWPDLPNVDVDENLDWDTQVEIYRAYTAFPNFFRTQTATWWQKEIQDFYNNIMK
FDGLWIDMNEPASFVHGTVGGKCLGDPLLENPPYMPPLESKHLGLNHKTLCMNSEQILNN
GRKVRHYDVHNLYGWSHTKPSFDALLSVTGKRGVVVTRSTYPSSGKWAGHWLGDNFSRWD
QLVKSIIGMMEFSLFGISYTGADICGFFEKADYEMCLRWMQLGAFYPYSRNHNSKGNPRQ
DPVSWDDSFAAASQKVLNIRYTLLPYLYTLMFEAHTKGSTVIRPLLHEFVKDKATWDIYR
QFLWGPALLITPALDQGVREVEGYLPNARWYDYHTAKDVGVRGEMISLPTPLSHINLHVR
GGYILPQQKPENTTYYSRKNPLGLLVALSDSGTAQGSFFWDDGEGIDTVGRNEYLLTSFS
AESNKLTSQVVHNGLTAADHVILGEVKVWGAGNIRVTEATLIDPEGKPHQLTPQHDLETQ
ELIIDATSKAFSLHLPFTISWRTAF
NT seq 5478 nt NT seq  +upstreamnt  +downstreamnt
atggggctgaagcggtggtccaggctggagttgatccttataggcctgtttctattgatg
actgtggcggccatcactatgatcatagtttttgtcacagaagaacctggagtcattaaa
gatgaattcccctctggtgcatttgttcccaagtgtcccagcatatccctggatcagaga
atagactgttttcctgatgctggagcctcaaagatgaaatgtgagcagcgtggctgttgt
tggagtcctctggatgagagaaatgtcccctggtgtttcttctcaaccaaccagggatac
acagtggaacatctggaacatccaaacccttttgtaataaatgtccagctgaagagaatg
gccgctccctctttatttggtgcagacatagagcagctgacctttcatgctgaaatgcaa
acaaaaaatcgacttcgatttaagatctttgatgccaaaaacaggaggtttgaggtgcct
catgtgcacatccgtactgtcagcagtaacccatccagccccatcaccaacactctggac
attgcgcacaacccctttggcctcactgtgcgcagaaaggagaacagaagggccctgttt
gacaccacaataggcccactggtgtttgcagaccagtacctccagctgtctgctaagctt
ccatcccataatatatttggtctgggagagcatgtgcatacacgatatcgccatgacaca
aactggagaacctggcccattttcacaagagatacccaaccaaatgggagagcaaataac
ctgtacggacatcatcccttcttcctctgtctggaggatgagagcggaaagtcctttggg
gtttttctcctgaacagcaacgccatggaggtgactctgcagcctgctccagctgtgacc
tacaggaccatcggagggatctttgacttctacatcttctttggagatacgccagaacaa
gtggttcaagagtaccttgagctaatcggccggccggtcattcctccctactggtcaatg
ggattccagctttctcggtggaactacgggaacctgagtgaagtcaagagagtagtggag
aggaaccgcgctgtgggcctcccatatgatattcagtacactgacattgactacatggag
cacatgaaagatttcacctacgacccagtccggttcaaggagctgcctgagtttgctgaa
tacctccatgagaaaggacagaagtacatccttatcctggatcctgcaatagccaccagt
aggagggtggggggtgctccatatgagtcttatgaccgtgggatggaaaagaacgtctgg
gtcacaaaatcagatggaagaactcctatagtaggacgggtttggccaggggagactgtg
tttccagatttcacaagtgagacctgcattgattggtgggtcgatgaatacgaacgtttc
tacagggagatcaaacatgatgccctctggattgacatgaatgaggtgtctaatttttta
aaaggatcaaccaccggctgtgaggacaacaaactcaactacccaccttacacaccaaag
attctgaatgagctcctctacagtatgactctttgtatggatgccaaacaggaatggggg
gacaactatgatgtccacagcttgtacggctattctatggttctggctacagaaaaagct
ctgcagcatgtatttggacccaaccgtaccatgatgctgacacgttcctccttcccaggt
gtgggaaagtattcagggcactggttgggagacaatactgccacttggaacgacatcaag
tgggccattcatggaatgttggagtttgggcttttcggaattccttatataggagcggac
atctgcggattctttggagactcaagtgaggagttgtgtcgtcgctggatgcaggttgga
gctttctaccccttcagtcgaaaccacaacgctatgaatttcaagccacaggatccagct
gcatttggggctgactcagtactggtgaaaacctccaaacattacctcaggatccgctac
acactcctgccctacctctacacactcttctacaaggcccacaccacaggggagactgtg
gtacggcctgtgctgcatgagttctactctgatagagccacctgggacgtggacctccag
tttctctgggggaaacacctgctcatcacaccagtgttggatccgggtgtggacacaatc
agggtttacataccagatgctgtgtggtatgactatgagacgatggaacgattgacagat
cgcagaaagcatgttgatatgtatctaccagctgacaagcttggattacacatcagaggt
ggtgctgtcctccccacacagagacctgaagtcactactacacacagtcgtagcaacccc
atggggttggtcatcgctcttgacgacaacaaccaggcagctggagagcttttctgggat
gatggagattctcgagatacagttaataatggaaactacatccactataagttctctgtg
atctatggagtattgaccatgcaggtgaccaaagctggatacaaagacccaaacaacctc
aaatttgagaacatcactgttctcggggtgcctcatcctcccacatctgtctctgtgact
catgttaacacagggagtcacttaggtgcaaccacagtgctgccaaacaccaacatatac
catgatggagccaaagaggtccttttcctccacggtctgtctttgactctaggggagacc
tatctggttcggtgggacatggaggatgaagaacttcagcgttttaactgccatcctgaa
gagaatgcagatgaagctaaatgcaagagcagaggctgcatctggaagccaagcagcact
gaacgtgtcccatggtgcttctacccaaaagactatggctatgttgtcacggcagccaca
gaaactgattctggcatcatggtggacatcactcggaacgtgaaacacaggattagtgct
cgtcctgactcgccagacattaacaacctccgtgttgagattcgatatcatacgagtgac
ttgctccagttcaagatctgggacccgacctcagatcgctttgaggtgcctgtgccattg
tccactcctgatgctcccgagactgatgagaacaaaaggctttacaaggttttaataagc
aataaaccgtttggcatccaggtcatcaggaggagcacaggaaccaagatctgggactcc
tcggtaccaggctttaccttttcagacatgttcatccaagtgtcgactcgcctgccatcc
aagttcatctacggctttggagaaacggaacatcccacttttaaacacgatctcaactat
cacacctggggtatgttctccaaggaccagcccccaggctacaaaatgaactgttatggg
gttcatcccttctacatgggccttgaggacacagccgacgcccacggggtcctgctgctc
aacagtaatgctatggatgtgacttttcagccaactccagctttaaccttccgtacagtc
ggaggcatcctggatttctacatggttctgggacccacacctgagatggttgtgcaggag
tacacagctctgattggacgacctgttctaccagcctactggtcccttgggttccagctc
tgtcgctatggatacgctaatgactcagaaattaaaagtctctacaaagacatgagggca
gctggtattccctatgacgtgcagtatgcagacatcgattacatggagcgtcagcttgac
tttgtcctggactcagagtttgcaggtctcccagctgtggtggactcaatgagaaacgaa
ggcatgcggttcatctttattctggatccagcgatttcaggcaatgagaccagataccct
gcttttgaaagaggacaagcagctgatgtcttcatcaaatggcccaaacatcttaaagat
gacattgtttggggaaaggtatggcccgatctcccaaatgtagatgtagatgaaaatctt
gactgggacacccaagtagagatctacagggcgtacacagcattccctaactttttccga
acccaaacagccacatggtggcagaaagaaatccaggatttctacaataacatcatgaag
tttgatggcctttggattgacatgaatgaacctgctagttttgttcatggaacagttgga
gggaagtgtctgggtgaccctctactagagaacccaccgtacatgccacccctggagtcc
aaacaccttggtttaaaccacaagacactttgcatgaacagtgaacagattcttaacaat
gggaggaaagtgcggcactacgacgtccacaacctgtatggatggtcccacaccaaaccc
tcctttgacgctctgctgagtgtgacgggtaaacgaggagttgtggtgaccaggtcgact
tatccctccagcggaaaatgggccggtcactggctgggggacaatttttcccgctgggat
cagctggtcaaatctattataggtatgatggagtttagtctgtttgggatctcttatact
ggagcagatatatgtggcttctttgagaaagcagattatgagatgtgtcttcgctggatg
cagcttggagctttctatccatactcacgcaaccataacagcaaaggaaacccgagacaa
gatccggtttcctgggatgacagttttgctgctgcttcccagaaagtcctgaacatccgc
tacaccctcctgccgtacctgtacacactgatgtttgaggctcacaccaaaggaagcacg
gtgatcagaccgctgttacacgagtttgtgaaggacaaagctacgtgggacatttacaga
cagttcctgtggggacctgctctactcatcactcctgctctagatcagggagtcagagag
gtggaaggctaccttcctaatgcacgctggtatgactatcacacggccaaggatgttggg
gtccgtggtgaaatgatcagcctgccaacaccactgagccacattaaccttcatgtcaga
ggagggtatattttacctcagcagaagccagagaacacaacgtattacagtcgcaagaat
cctttaggactccttgttgctctgagtgactctggaacggctcaaggctcctttttctgg
gatgatggagaaggaatagacacggtggggagaaacgagtatcttctgacgtccttttca
gcagaatcaaacaagttgaccagtcaggtggttcacaatggactgacagctgctgatcac
gtgattttgggtgaggtgaaggtttggggtgcaggcaacatcagggtcacagaggcgacc
ctaatagacccagaaggaaagccacatcaactcactcctcagcatgacctggaaactcag
gagctgattatagatgccacatcaaaggctttttctttgcatcttccttttacaataagt
tggaggaccgccttctga

DBGET integrated database retrieval system