KEGG   Nothobranchius furzeri (turquoise killifish): 107374754Help
Entry
107374754         CDS       T05163                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00590  Arachidonic acid metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107374754
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107374754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 107374754
NCBI-ProteinID: XP_015798480
UniProt: A0A1A8UE88
LinkDB All DBs
Position
sgr02
AA seq 598 aa AA seqDB search
MRASVLGSACALLLLLRQPACQGDEVTASTVNPCCYFPCQHWGVCVRYGRDKYECDCTHT
GYYGENCTIPEVWTRMRQFLRPRPDVVHHILTHFQWLWDIINNTFLRNALMRLVLTVRSN
LIPSPPTYNSKYGYLSWESYSNLSYYTRLLPPVPEDCPTPLGIKGINGLPDPDVLVERLL
KRRTFRPDPQGSNLMFAFFAQHFTHQFFKTYNRMGLGFTKALGHGVDAGHIYGDNLERQL
DLRLLKDGKLKYQVIDGEMYPPSVVDAPVRMSYPPDVPVQNQMAIGQEVFGLLPGLGMYA
TLWLREHNRVCEILKSEHPTWDDEQLFQTTRLIIIGETIRIVIEEYVQHLSGYLLQLKFD
PTLLFHSHFQYGNRIALEFSQLYHWHSLMPDTFHINGDELSYKQFLFNTSILTHYGVEKL
VEAFSRQPAGQIGGGHNINFLVTKVAAGTIKESRELRIQPFNEYRKRFNLEPYTSFREFA
DNEEIANTLEELYGDIGALEFYPGLLLEKTRPGAIFGESMVEMGAPFSLKGLLGNPICSP
DYWKPSTFGGKVGFDIVNSATLKKLVCLNTRTCPYVAFRVPTEDSLRKNGEKVHPDEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctctgtcctaggatcagcctgtgcccttctcctgctgttgcgacagcctgca
tgccagggggatgaggtcacggccagcacagtgaacccatgctgttacttcccctgccag
cactggggtgtgtgtgtgcgctatggcagagacaaatatgagtgcgactgcacccacacc
ggctactatggagaaaactgcacaatccctgaggtttggactcgcatgcgtcagttcctg
agaccccgtccagatgtggtccaccacattctgacccatttccagtggctctgggacatc
atcaacaacaccttcttacggaacgccctcatgcgccttgtgttaacagtgaggtctaat
ttgatacccagccctccaacctacaactcaaaatacggctacctcagctgggaatcctac
tccaatctcagctactacactcgtctcctgcccccggtgcctgaggactgccccactccc
cttgggatcaaagggattaatgggctgcctgaccctgatgtgctggttgagaggctcctg
aaaagacggacattcagacccgacccacagggatccaacctcatgtttgccttctttgct
cagcactttacccatcagttcttcaaaacctacaatcgaatgggactgggtttcacgaag
gcccttggacatggggtggatgcaggtcacatttatggagacaacctggaacgtcaacta
gatctgaggcttttgaaagatggaaaactgaaatatcaggttattgatggagagatgtac
cccccctctgtggttgatgcacccgtcaggatgagctaccctccagacgtccctgtccag
aaccagatggccattggtcaggaggtgttcggactccttccaggattgggaatgtatgct
acgctgtggctcagggagcacaaccgggtctgtgaaatcctgaaatcagaacaccccacc
tgggacgacgagcagcttttccagaccactcgcctcatcatcatcggggagaccatacga
atcgtgattgaggagtatgtgcagcacctgagcggctacctgctgcagctgaagttcgac
ccaaccttgctgtttcactctcacttccagtatgggaaccgcattgcactggagttcagc
cagctctaccactggcactctctgatgcccgacaccttccacataaacggagacgagctg
tcttacaagcagttcctcttcaacacgtccattctcacacactacggcgtggagaagctg
gtggaggccttctcccgccagcctgctggccagattggtggaggccacaacatcaacttt
ctagtgaccaaagtagctgcaggaacgataaaggagtcacgcgagcttcggatccagcct
ttcaacgagtacaggaaacgtttcaaccttgagccctacacgtcgtttagagagtttgct
gataacgaggaaatagccaacacactcgaagagctctacggtgacattggcgcccttgaa
ttttaccccggactacttttagagaaaacgcggccaggggccatatttggagaaagcatg
gtggaaatgggtgccccattttctcttaaaggcctcttgggtaatcccatatgttctcca
gattactggaagcccagcacctttggaggcaaagtcggcttcgatattgtaaactctgcc
accctgaagaagctggtctgcctgaacaccaggacatgcccttatgtagcattcagagtt
ccaacagaggactcattaaggaagaatggtgagaaggttcatcctgatgaactatga

DBGET integrated database retrieval system