KEGG   Nothobranchius furzeri (turquoise killifish): 107375066
Entry
107375066         CDS       T05163                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107375066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107375066
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:nfu03310]
    107375066
Transcription factors [BR:nfu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107375066
Nuclear receptors [BR:nfu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107375066
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107375066
NCBI-ProteinID: XP_015798901
UniProt: A0A1A8AMF4
LinkDB
Position
sgr01
AA seq 776 aa
MNRGGGKKVTFRGNDHLSKLVYTESPEEGGLLKVAPHSAVSLTSASSIVLPSSPLMQPGQ
VANGLSNSPFPDELTSASAPATIGSLVESPEPRGVTKDIRLQQTLLFQTQTSTAFGHQNL
PQLEASMVDITQSSMDSLIGGSDPNLFAMKTEDFSLDKGEQDPTDFDNAFDSISKDVDMN
QKLFNDASLDLLQEFDLTASPSDFYVGDDAFLTTLVDESLLVDGEIRGTFERDIKPAIIE
SINTTGALTAALDGNSATSPHESISGFSSPASTPTTTLPVVVKKEKDTGFIQLCTPGVIK
QEKAAGGYCQISSTNPISICGVSTSGGQSFHFGVNSRNNESLLQKDQKPVSGLYLPVTTI
GGAWNRSPSVGDNSPIHRSDDAFSSSPTYPSSFGSSAPRLEGGTASSTAQGKSGAHKICL
VCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCL
MAGMNLEARKAKKLNRLKGVQSSNPPELMPSPPIEAHSIVPKCMPQLVPTMLSLLKAIEP
DTIYAGYDSSLPDTSTRLMSTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWL
FLMSFSLGWRSYQQCNGNMLCFAPDLVINDERMKLPYMAEQFEQMLKISSEFVRLQVSHD
EYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKL
LDSMHEMVGGLLSFCFYTFVNKFLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQR
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgaatcgaggtggagggaagaaggtaacattcagaggaaatgaccatctgagcaagctg
gtctacaccgagagtcctgaagagggaggtctgttaaaagtggcccctcatagcgctgtg
tccctcacctctgcctcttccatcgttcttccatccagccccctgatgcagccaggacag
gtggcgaacggtctcagcaacagcccctttccagatgagcttacctccgcctcggcccct
gccaccattggttccttggtagaaagtccagaacccaggggtgtgaccaaagatattagg
cttcagcagacactcttatttcagactcagacttccactgcttttgggcatcagaacttg
ccccagttggaggccagtatggtagacattacccagtcctccatggattctctcatcggg
gggtcagaccccaacttgttcgccatgaaaacagaagatttctccttggataaaggagag
caggatcccactgattttgataatgccttcgactcaatcagtaaagatgtggacatgaac
cagaaactgttcaacgatgcatctctggaccttcttcaggagtttgacctcacggcatcc
ccctctgacttttatgtaggagatgatgcatttctgaccactttggtagatgagtctttg
cttgtggacggggaaatccgaggcacattcgaaagggacataaaaccggccataatcgag
agcattaacaccactggggcgctcactgctgccctcgatggcaacagtgctacaagtcca
catgaatccatctcaggcttctcctcccctgcttccaccccgaccaccactttgcccgtc
gtggtgaaaaaagagaaagatacaggcttcattcagctctgcaccccaggtgtgattaag
caggagaaggctgctggaggctactgtcaaataagctccacaaaccccatttccatttgt
ggggtgagcacttcaggaggacagagctttcattttggagtcaactccagaaacaacgag
tctctgctgcagaaggatcagaagccggtgtccggcttgtaccttccagtgacgaccatc
ggtggagcctggaaccgtagcccgagtgtgggcgacaactcgccaatccaccggtctgat
gatgccttctccagctcccccacctaccccagcagctttggcagttctgcccccagactg
gaagggggcaccgcctcatccacggcacaggggaagagtggcgcccataaaatctgcctg
gtgtgttctgatgaggcttcgggctgccattatggcgttctcacctgtgggagctgcaag
gtcttcttcaagagagcagtggaaggtcagcataactacctgtgtgctgggaggaacgac
tgcatcatcgataagatcaggcggaagaactgtcccgcttgccgcttccgcaagtgtctg
atggcagggatgaacctcgaagctcgcaaagccaagaaactgaatcgcttaaaaggcgtc
cagagcagcaacccccccgagctgatgccttcgccccccatcgaggcccattccatcgta
cccaagtgcatgccgcagctcgtccccaccatgctgtctctgctcaaggccatagagcca
gacaccatctacgccggctacgacagctccctccctgacacctccacccgcctcatgagc
accctcaacaggctgggggggcgacaggtcatctctgccgtgaagtgggccaaggctctt
ccaggttttaggaacctgcacctggacgaccagatgaccctgctgcagtgctcctggctg
ttcctcatgtccttcagcctcggctggaggtcgtaccagcagtgcaacgggaacatgctc
tgctttgccccggaccttgtcattaacgacgagcggatgaagctgccctacatggccgag
cagtttgagcagatgctgaagatttccagcgagtttgttcgcctgcaggtttctcatgac
gagtacctttgcatgaaggtcctgctgctgctcagcacagtacccaaggacggcctgaag
agccaggcggtgtttgatgagatccgcatgtcatacatcaaggagctggggaaagccatc
gtgaagcgcgaggagaattccagccagaactggcagcggttctatcagctcaccaagctg
ctggactccatgcacgagatggtcggcggcctgctcagcttctgtttctacacctttgtg
aataaattcctgagcgtagagtttcccgagatgctggcggagatcatcagcaatcagtta
ccaaaattcaaggccgggagtgtcaaaccgctcctcttccatcagagatga

DBGET integrated database retrieval system