KEGG   Nothobranchius furzeri (turquoise killifish): 107375089
Entry
107375089         CDS       T05163                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107375089
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107375089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nfu04052]
    107375089
   00536 Glycosaminoglycan binding proteins [BR:nfu00536]
    107375089
Cytokines and growth factors [BR:nfu04052]
 Growth factors
  Growth factors (RTK binding)
   107375089
Glycosaminoglycan binding proteins [BR:nfu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107375089
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107375089
NCBI-ProteinID: XP_015798934
UniProt: A0A1A8B8V1
LinkDB
Position
sgr01
AA seq 158 aa
MADGDALIAGDQAEDGGLSLLLDYRRRTQLYCMNGGYHLQILPDGTVQGQREDRDVHTVL
KLRAVDRGVVVIQGTETERYLAMSEEGRLYGSRAVTDECYFLEKLEENHYNTYQSQKYQD
NQWYVALKKNGKPKLGPRTHIGQKAIFFLPRRIDFSQD
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcggatggagacgcgctcatagccggggatcaggccgaggacggcggcctgtcgctg
ctgctggactaccggaggaggacccagctctactgcatgaatggcggatatcacctccag
atccttcctgatgggacggtgcagggccagagggaggaccgggacgtgcacaccgtctta
aagctgagagctgtggaccgaggcgtggtggtcatccagggaacagaaacagagagatac
ttggccatgagtgaggaggggcgtttgtacggttcacgtgcagtaactgatgaatgttac
tttctggagaagctggaggagaatcactacaacacctatcagtcacagaagtaccaggac
aaccagtggtatgtggccctgaaaaagaacggcaaacctaaacttggtccaagaacccac
atcggacagaaggccattttcttcctgcccagacggatagacttcagccaggactga

DBGET integrated database retrieval system