KEGG   Nothobranchius furzeri (turquoise killifish): 107376530Help
Entry
107376530         CDS       T05163                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00052  Galactose metabolism
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
nfu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107376530 (gaa)
   00500 Starch and sucrose metabolism
    107376530 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107376530 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfu04147]
    107376530 (gaa)
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107376530 (gaa)
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107376530 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107376530
NCBI-ProteinID: XP_015801150
LinkDB All DBs
Position
sgr03
AA seq 942 aa AA seqDB search
MAGLPSLSVIVVVLALLLLACWHSNLLLIYKGRLVRSVPRTPSRIIIAADKWLKYYPTKP
QNFLKSRPGSHQSNGVSGRSECSMASESRFDCGRDRVLSQDECEERGCCYSPLPGSSGPP
WCFYPSLYPGYKMSPITPTKRGQTASLTRVTPSYLPKDIFNLSLEVTEETAGCLHITLKD
PSTQRYEVPLLDGIRHTKASSQNVLYTTEYQSDPFGFIVSRKSSGTIIMNTTVAPLLFAD
QYLQLSTSLASSFVSGLGEHYTPLILDLNWTSLSLWNRDMAPHADANLYGSHPFYIVQED
DSLAHGVFLLNSNAIEVMLQPTPALTWVSIGGILDLYIFLGPDPQSVIQQYLQIIGYPMM
PPYWSLGFHLCRWGYTTTNATRMVAQHMHSANFPMDVQWNDLDYADKRRVFTFDRVRFGD
LPEMVQEFHEGGMKYILILDPGISSTSPFGTYPPFEDGLKQDVFIKNATGQVLIGKVWPG
PTAFPDFTNPETRQWWEDCIRDFYSEVPVDGLWIDMNEPSSFIQGSVDGCPDSELERPPY
TPTSSDVTLTGVVGGQLNTGTICMSAQQKLSTHYNLHNLYGLTEADATHSALQKIRRKRP
FVLSRSSFPGIGRFSGVWTGDVRSNWEQLRLSIPAVLQFSLFGVPLVGADICGFGGNTTE
ELCVRWMQLGAFYPFMRNHNDKPNAPQEPFVFGQAAQAAMRSVLNLRYSLLPYLYTLFHH
AHTSAATVATPLFTEFPADANCRIIDQQFLWGSSLLISPVLDEGSVEVKAYLPAGTWYSL
QNGQPLYSKGEYFLLPAPLETINVHVREGHIIPQQEPALTTTVSRGNAFFLTVALSASGQ
ARGVLFWDDGDSLDTFEMENYSYLIFTAGESQVSSDPQRLNGDLDALVLGGLQVFGVPSP
PLHVLANGVEASEFTYCADSKVLTVTSLALPMSEMFTVQWAL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtctgcctagtttaagcgttattgttgtcgtccttgccttgcttctgttagca
tgttggcatagcaaccttttgttaatctataaaggcagactggttagatcagttcctcgc
acacccagcaggattatcatagcagctgataaatggctcaaatattatccaacaaaacca
caaaactttttaaagagccgcccgggaagccatcaaagtaatggagtttctggaagaagt
gaatgcagcatggcttcagagagccgctttgactgtggcagggacagggttctgagtcag
gacgagtgtgaagagagaggatgctgctactctcctctacctggatcatcaggaccaccc
tggtgtttctacccctctctgtatccgggttataaaatgagtcccatcactcccaccaaa
agaggtcagactgccagcttgactcgagtcacaccatcatatctccccaaagacatcttc
aacttgagccttgaagtcacagaggagactgcaggctgcctgcacatcactttaaaggac
ccttccactcagcggtatgaagttcctcttcttgatggcattcgtcacacaaaagcgagc
agccagaatgttctttacaccacagaatatcagtctgatccatttggtttcatagtgagt
cgtaaatccagcggaacaatcataatgaacaccacggtggcccctctgctgtttgctgat
cagtacctgcagctgtccacctcactggcctcctcctttgtgtctggccttggagaacat
tacacccctctcatcctggacctcaactggacctctctgtctctttggaacagggacatg
gcacctcatgctgacgcaaacctctatggctcccatccattttatatcgtgcaggaagat
gacagcctagcacacggagttttccttcttaacagcaatgcaattgaagtgatgctgcag
ccgactccagctctcacctgggtatccattggtggaatcctggatctgtatatttttctt
ggtcctgaccctcaaagtgtgatacagcagtacctccagatcatcggatatcctatgatg
cctccttattggtccctgggctttcatctgtgtcgctggggttatacaaccactaatgca
acccgaatggtcgcacaacacatgcacagtgccaactttccaatggatgttcagtggaac
gacctggactatgccgataagcgcagggtgttcacctttgaccgtgtgcgattcggagat
ctgccagagatggtgcaggagtttcatgaaggaggcatgaagtacatcctaattctggac
ccgggtatcagcagcaccagcccctttgggacttatcctccttttgaagatggactgaaa
caagacgtctttattaaaaacgccaccgggcaggttctaattgggaaggtttggcctggc
ccaacagcatttcccgacttcaccaacccagaaaccagacagtggtgggaggactgcatc
agagacttttattctgaagttcctgttgatggtttgtggattgacatgaatgaaccctcc
agtttcattcagggatcagtggacggctgtccagacagtgagctcgagagaccaccatac
actcccacttcttctgatgtcacactaacaggagtagttggaggtcagttgaacacagga
acgatctgcatgtcagcccagcagaagctgtccactcactacaacctgcacaatctttac
ggactgaccgaagcggacgcaacacacagtgctctccagaagattcggaggaagagaccc
tttgttttgtctcgctcctcttttcctggtattggacgtttctctggagtgtggacgggg
gacgtcaggagcaactgggagcagcttcgactctccatccctgcggtgctgcagttcagc
ttgttcggggttcctctggtgggagcggacatctgcggctttggaggcaacaccactgag
gagctgtgtgtgcgatggatgcagcttggtgccttttacccatttatgaggaaccacaac
gacaaacccaatgctcctcaggagccgtttgtgtttggacaggcagcccaggcagccatg
cgtagtgtgttaaacctccggtactcccttctcccttacctctacacactcttccatcat
gcacacacttctgctgccacagttgccacacctctcttcacggagtttcccgctgatgct
aactgtcggattatagaccagcagttcctgtgggggagttcacttctcatcagtccagtt
ttagatgaagggtcggttgaagtgaaagcgtacctgccagccggtacttggtacagcctt
cagaacggccagcccctctacagtaagggggagtatttcctcctgccagcacctctggaa
accatcaatgtacatgtgagggagggccacatcatcccccagcaggaaccagctttgacg
accacggtttcacgcgggaacgctttcttcctgacggtggcactgtcagccagcggtcaa
gccaggggggtcttgttctgggatgatggagacagtctggacacatttgaaatggaaaat
tatagttatctgatatttactgctggcgagtcccaggtttctagtgaccctcagaggctg
aacggggacctggacgctctggttctggggggacttcaggtgttcggggtgccctcacca
cctctccatgtgttggcaaacggggtggaagccagtgaatttacatactgtgctgactct
aaggttctgacagtgaccagcctggccttacccatgtctgagatgtttacggtccagtgg
gctctctga

DBGET integrated database retrieval system