KEGG   Nothobranchius furzeri (turquoise killifish): 107376658Help
Entry
107376658         CDS       T05163                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00500  Starch and sucrose metabolism
nfu01100  Metabolic pathways
nfu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107376658
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107376658
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nfu01003]
    107376658
Enzymes [BR:nfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107376658
Glycosyltransferases [BR:nfu01003]
 Polysaccharide
  Storage polysaccharide
   107376658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 107376658
NCBI-ProteinID: XP_015801369
UniProt: A0A1A8B0F8
LinkDB All DBs
Position
sgr03
AA seq 723 aa AA seqDB search
MPLARSLSVTSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDQMNASGCKIYFGRWLIEGSPYVVLIDVG
FTAWSLDRWKRELWEHCGIGVPWFDREANDAVLFGFLTAWLLGEYAAQSEESPHIVAHFH
EWLAGLGLVLCRQRQLPIATIFTTHATLLGRYLCAGSVDFYNNLAQFNVDKEAGDRQIYH
RYCLERAAAHCTHVFTTVSQITAIEAEHLLKRKPDIITPNGLNVKKFSAMHEFQNLHAQS
KSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADVFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKEDFTIMKRAIFATQRQSQPPVCTHNMLEDSSDPILSCVRRIGLFNSSSDRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRFYIAARHMALAKAFPDTFIYEPEETASTAGFRYPRPASVPPSPALSRHSSPHHSEAE
DNEEDERYDEELEAEKDRVNIRQPYTMPVKNKVSAVLGANGDGEGDVNGDENGDGDEVTS
EKN
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccgttggcccgcagcctgtccgtcacgtccctgtcaggacttgaagagtgggacgaa
gagtttgatttggaggatgctgttcttttcgaaatagcttgggaggtcgcaaataaagtt
ggaggaatctacaccgtcatccagaccaaagcccgtctgaccgcggaggaatggggggag
aactatttcctcgtggggccctatgtggagagcaacgtgcgcactcaggtggagctgatc
gaacccaccaacccggtgctaaaacgcaccattgaccaaatgaacgccagtgggtgtaag
atttactttggccgctggctcattgaagggagtccttatgtggttctgatcgacgtcggc
ttcaccgcctggtctctggaccgctggaagagggagctgtgggagcactgtggcatcggc
gtgccgtggttcgaccgtgaggccaacgatgctgtgctgtttggcttcctgactgcgtgg
cttctgggagagtacgcagctcagagcgaagagtctccacacatcgtggcccatttccac
gagtggctggctggactcggcctggtactgtgtcgacagagacagctccccattgctact
atattcaccactcatgctacgctgctgggacgctacctttgtgctggaagcgtggacttt
tacaacaaccttgctcagttcaacgtggacaaggaagctggtgatcgacagatctaccat
cggtactgtttggaacgggcggctgctcactgcactcacgttttcaccacagtgtcacag
attacagctattgaggcggagcacctgctcaagaggaaaccagacatcatcactcccaat
ggactcaatgtgaagaagttctctgctatgcacgagtttcaaaacctccacgcccagagc
aagagccgcatccaggagtttgtcaggggacacttctatgggcacctcgacttcaacttg
gacaagtgtttgttcctcttcatagctgggaggtacgagttctccaacaaaggagccgac
gtcttcttggaggctttagccagactcaactatctcctgagagtcaaccacagcgacgtg
actgttatagcgttcttcatcatgccagctcgcacaaacaacttcaacgtggagaccttg
aagggccaagctgtccgaaagcagctctgggatacagctcagactgtgaaggaacgcttt
ggaaagaagctttatgagtcacttctagttgggcagttgccagatgtctccaagatgctg
gacaaagaggacttcaccataatgaagcgtgccatctttgcgactcagaggcagtcccag
cctccagtttgtacccacaacatgctggaggacagcagcgaccccatcctcagctgtgtc
cgccgcatcggccttttcaacagctcctctgaccgagtcaagattatcttccatccagag
ttcctttcatctacctctcctctgcttcccatggattatgaggagtttgtccgaggttgc
caccttggcgtcttcccttcttactatgagccttggggctatacaccagctgagtgcaca
gtcatgggaattccttcaatctccaccaacctctcaggttttggatgtttcatggaggaa
cacatagcagacccttcggcatatggtatttacatccttgatcgccgttacaagggggtt
gatgagtcatgcaaccagctcacctccttcctgttccagttctgcaagcagagccggcgc
cagcggatcatccagagaaatcgcacggagcgcctcagtgacctcctggattggagatac
cttggcaggttttacatagctgctcgtcacatggccctggctaaagccttccctgacacc
ttcatatatgagcccgaagagaccgcctcgactgcaggtttccgttacccccgacctgcc
tctgtgccgccatctccagccctgtcccgtcactcctccccgcaccacagtgaggccgaa
gacaacgaggaggacgagcgttacgacgaggaactggaggccgaaaaggatcgagtgaac
atccgccagccctacacgatgccagtgaaaaacaaagtgtcagctgtcctgggagccaac
ggagatggagagggagatgtgaacggagatgagaacggagatggtgacgaagtgaccagc
gagaaaaactga

DBGET integrated database retrieval system