KEGG   Nothobranchius furzeri (turquoise killifish): 107376749
Entry
107376749         CDS       T05163                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04137  Mitophagy - animal
nfu04210  Apoptosis
nfu04218  Cellular senescence
nfu04620  Toll-like receptor signaling pathway
nfu04621  NOD-like receptor signaling pathway
nfu04622  RIG-I-like receptor signaling pathway
nfu04623  Cytosolic DNA-sensing pathway
nfu04625  C-type lectin receptor signaling pathway
nfu04920  Adipocytokine signaling pathway
nfu05132  Salmonella infection
nfu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107376749
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107376749
  09143 Cell growth and death
   04210 Apoptosis
    107376749
   04218 Cellular senescence
    107376749
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107376749
   04621 NOD-like receptor signaling pathway
    107376749
   04622 RIG-I-like receptor signaling pathway
    107376749
   04623 Cytosolic DNA-sensing pathway
    107376749
   04625 C-type lectin receptor signaling pathway
    107376749
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107376749
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107376749
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107376749
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107376749
Transcription factors [BR:nfu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107376749
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107376749
NCBI-ProteinID: XP_015801491
LinkDB
Position
sgr04
AA seq 633 aa
MDGVYRWGMTPHNSVQTTNPHIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTNNNPFNIPEPKVWEEEFDLNSVRLCFQASITGPTGELFPLEPVV
SQPIFDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLGEPIKVKMQLRRPSDREVSEPMDFQYLPSDPDEYRLS
EKRKRTGDMFQNLKLGPMLSSVSISQERRPMNSARRVTPKPISMSAQAVTEAPPGASGMK
PQSTYSCIQPAQFASVQPKVTTAAATEPWKIMESLKMGPQPKNNPLPFIMSSAAPPASMA
PTTSATAASQDYQTVNLSDLHEFFPNMSSAISQEPAAAQGNTEPTQPGTIFSNPDSQFQV
ETTLVDEDFPSFSDAQVPSTLDSLNMEDLVDLLNPRLDVGNSASMFVAVPNSAAGPHNGS
VSQNPSEPVSNPGSTYMNYPNSIANLLRSETMMVAGPGSSSNHQPTVLDDLEELMSADEE
RLISILTAEAMLGLCRDTQPRSSPPKDLFCPPS
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggacggtgtgtaccgatgggggatgacccctcataactcagtccaaacaacaaaccct
cacatcgagatcattgagcagccgaagcagagggggatgaggtttcggtacaagtgtgag
ggccgttcagccggcagcattcctggagagaaaagcaacgacacgacgaagacctacccc
gccatcaaggtgcacaactacagcggtcccctacgggttcgcatctctctggtgacaaag
aatcccccgtacaaaccccatcctcacgaactggtggggaaagactgtaaacatggctac
tacgaggccgacctgcaggagcgacggatacacagttttcagaacctgggtatacagtgt
gtgaagaagaaggacgtgaacgaggccatcacctgtaggctgcagacaaacaacaacccc
ttcaacattcccgagcccaaggtgtgggaggaggagtttgacctgaattctgttcggctt
tgcttccaggcctccatcaccgggcctactggagagctgtttcccctggagcctgttgta
tcacagcccatctttgacaacagagccccaaacacagctgagttaaagatctgcagagtc
aaccgcaactcggggagctgcaaaggaggggatgaaatcttcctgctgtgtgacaaagtg
caaaaagaagacatcgaggtgcgcttcttccaggattcgtgggagggcaagggcacgttc
tcccaggctgacgttcacaggcaggtggcaattgtgtttcggacgccgccgtaccgcgac
actaaccttggtgagcctattaaggtcaagatgcagctccggcggccatctgaccgagag
gtcagcgagccgatggacttccagtacctaccgtctgacccagacgaataccggctgagc
gagaagaggaagcgaacaggagacatgttccagaacctcaaactgggtcccatgttatct
agtgtgtccatttcacaagagaggcgaccgatgaactctgcacgaagagtcacacctaaa
cccatctcaatgagcgcccaggccgttactgaagcgccccctggtgccagtgggatgaaa
ccgcagtccacctactcgtgcattcagccagcacagttcgcttcggtccaacccaaagtc
actacagcagctgcgactgagccctggaagatcatggagagtctaaagatgggccctcag
cccaaaaacaacccacttccctttataatgagctcagcagcaccccctgcctccatggcc
cccaccaccagcgccaccgcagccagccaggactaccaaacagtcaacctgtcagacctt
catgagttcttccctaacatgtcctcagccatctcccaggagccagcagctgctcaggga
aacacggagcccacccagcccggcaccatcttctccaacccggactctcagttccaagtg
gaaacaacactcgtggatgaggacttccccagcttttccgatgcccaggttcccagcacc
ctggacagtctaaacatggaggaccttgtggacctattgaacccccgacttgatgttgga
aacagcgcctccatgtttgtggccgttcccaactctgctgctggcccccataacggctca
gtgtcccagaacccctctgaaccagtcagtaacccaggaagcacctacatgaattacccc
aacagcatcgctaacctgctgcggagcgagaccatgatggtagctggtcctggcagcagc
agcaaccaccagcccacggtgctggacgatctggaggagctgatgtctgccgatgaagag
cgtctcatttcgattttaacagcggaagccatgctgggtttgtgtcgggacacccaacct
aggagtagtccccccaaagacctcttctgtccgccctcctga

DBGET integrated database retrieval system