KEGG   Nothobranchius furzeri (turquoise killifish): 107377057Help
Entry
107377057         CDS       T05163                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
Enzymes [BR:nfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107377057 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 107377057
NCBI-ProteinID: XP_015801934
UniProt: A0A1A8V1H9
LinkDB All DBs
Position
sgr04
AA seq 746 aa AA seqDB search
MSTVSDQSGATSAPSPAPPAPLGRPPKLSSRGRFSAPIGTSNSETTDIPELEYFGAPGPR
GYPPLTDFLDIWDVDMMKRPDESNKIEHHTTLYHSDYLIVRRGQEFEIKITFNRPYKPNE
DKFAVEFVIGSSPAISKGTYVPVFPKKEKQSSWRGRIKETSDNIVTMGLTPIADCIVGKY
NMYVAVQTPFGTRRTRKDDSRAVYILFNPWAADDAVFLDDEKERQECVMNEVGIIYHGAY
DDISERDWNYGQFNFGVLDACLLVMDRSEMPITNRGDPIKVTRKASAMINSRDDDGVLVG
NWSGDYTYGVAPTSWTGSTDILLTYASTKMPVCYAQCWVYAAVFNTFLRCLGIPSRVVTN
YFSAHDNDGNLRTDIILDENGRVDRNRTRDSIWNYHCWNECYMSRPDLPQGFGGWQVVDA
TPQETSDGMYRCGPASVQAIKHGDICYPFDAAFVFAEVNSDVVYYSRKKDGTMQLIKVNR
THVGRMVLTKAAGEVTRRDITDNYKFSEGTSEERTVLEKAEEYGCKRENSNPPLADVDVI
LPTLEIGVGDDFELNLEFVNRSDQRRTVGTYISGSVVYYTGVSSHEFLFRTPTVTIQPQG
SVTESVMIESKNYMHHLVEQANLNFIVTGKIKETGKIVTSMKVITLHNPKLLVEVTGNAI
VNEEMIARVEFTNPFTHTLKDVEVRMDGPGVMEHKKRLYSLIPGGTSLTWTEMFTPQRAG
KTRVFATLDCPGLRQVSGQASINVKP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtttctgatcagtcaggggccacctcggctccttcacctgctcccccagct
ccccttggacgtccacccaagttaagcagccgtggtcgattctcagcccccatcggcacc
tccaattctgaaacgacagatatcccagagttggagtactttggtgctcctggccccaga
ggataccctcctcttacagacttcttggacatctgggatgtggacatgatgaagaggccc
gatgagagcaataagattgaacaccacaccacgctgtaccactctgactatcttattgtt
cgtcgagggcaagagtttgaaatcaagatcacattcaatcgtccctacaaacctaacgag
gacaaattcgctgtagagtttgtcatcggttccagccctgcaatcagtaagggcacttat
gttccagtctttcccaaaaaggaaaagcaaagctcatggagaggtcgcatcaaagagacc
agcgacaacatcgtcaccatgggactcacccctatagcagactgcattgtgggaaaatat
aatatgtatgttgccgtacagacgccttttggcacccgcaggactagaaaggatgacagt
cgagctgtttacatccttttcaatccctgggcggcagatgatgctgtgtttctggatgat
gagaaagagaggcaggagtgtgtgatgaatgaggtgggaatcatttatcatggcgcctac
gatgacatttctgagagagactggaactatggacagttcaactttggagttctggatgcc
tgtctgttggtcatggacaggtctgagatgcccatcaccaacagaggagaccccatcaag
gtgaccagaaaggcctcagccatgattaactcccgtgatgatgacggggtgttggtgggg
aactggagtggcgactacacctacggagtggcgcctacttcctggactggtagtactgac
atcctgctgacttatgccagcaccaagatgcccgtctgctatgctcagtgctgggtctac
gccgccgtcttcaacaccttcctacgctgtctgggaatcccatctcgagttgtcaccaac
tacttctctgctcacgacaatgacggaaacctgaggactgacataatattggatgaaaat
ggcagagttgatcgaaaccgcaccagggattctatctggaactatcattgctggaatgag
tgctacatgtccagaccggacctccctcaaggttttggaggctggcaggttgtggacgca
acaccgcaggagaccagtgatgggatgtacaggtgtggacctgcgtcagtccaggccatc
aaacatggagacatctgctatccgtttgacgctgccttcgtctttgctgaggtaaacagc
gacgttgtgtattattctcgaaagaaagatggcacaatgcagctgataaaggtgaaccgg
actcatgtgggtcgaatggttttgaccaaagctgctggagaagtcactcgtcgtgacatc
actgataattacaagttttctgaagggacctcagaggagcggactgtcctggagaaagca
gaggagtacggctgtaaacgagagaactccaaccctcctttggctgatgtggacgtgatc
ctgccaaccctggagatcggggtcggtgatgactttgagctgaacctggagttcgtaaac
cgaagtgaccagcgccgtacagtggggacgtacatcagtgggagtgtggtgtattatact
ggagtctccagccatgagttcctgttcaggacccccaccgtaaccattcagccccaagga
agtgtgacggagtcagtgatgattgagtcaaagaactacatgcaccatctggttgaacag
gccaacctcaacttcattgtcaccggaaaaatcaaagagacgggaaagattgtcacctca
atgaaagtcatcaccctgcacaatcccaaactcctcgttgaggtaactggcaacgccata
gtaaatgaggagatgatagcccgggtggagttcacaaaccccttcactcacactctgaag
gatgtcgaagttcgtatggacggacccggggtcatggaacacaagaaaagactgtatagt
ctcatccctggaggtacctctctgacctggaccgagatgttcacacctcagagggctgga
aaaaccagagtgtttgctaccctggactgtcctggtctcaggcaggtgtctggccaagca
tccatcaacgtcaagccctga

DBGET integrated database retrieval system