KEGG   Nothobranchius furzeri (turquoise killifish): 107377632Help
Entry
107377632         CDS       T05163                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04068  FoxO signaling pathway
nfu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107377632 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107377632 (sod2)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107377632 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 107377632
NCBI-ProteinID: XP_015802863
UniProt: A0A1A8A8N9
LinkDB All DBs
Position
sgr04
AA seq 259 aa AA seqDB search
MMVQSVNLKWLSFKGSYLLARAHGSGYLLRSIRNMLSRLGQIRRCAASLSQSINQIAASR
QKHTLPDLTYDYGALEPHICAEIMQLHHSKHHATYVNNLNVTEEKYQEALAKGDVTAQVA
LQPALKFNGGGHINHTIFWTNLSPNGGGEPQGELMEAIKRDFGSFQKMKEKMSAATVAVQ
GSGWGWLSYDKESGRLHIAACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYVKA
IWNVINWENVSDRLQIAKK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgcagtctgtcaacttgaaatggctcagtttcaagggcagttatttactagcg
cgtgcacacggttctggttacctgctgaggtccattcgaaacatgctgagcagacttggg
caaatacgcaggtgcgcagccagcctcagccaaagcattaaccagatagctgcatcaagg
cagaagcacacccttcctgacctgacctatgattatggagccctggagcctcacatctgt
gcagagataatgcagctgcaccacagcaaacatcatgctacctatgtcaataacctcaat
gttacagaggagaagtatcaagaggctcttgcaaagggagatgtcactgcacaggtagcc
ctccagcctgctttgaagtttaacgggggaggccacattaaccacaccatcttctggaca
aatctttctcctaatggtggaggcgagccacaaggagagcttatggaggccatcaaacgg
gactttggctctttccagaagatgaaggaaaagatgtctgctgctacggtggcagtgcag
ggctcgggctggggatggctgagttacgacaaggagagtggaagacttcacattgctgct
tgtgcaaatcaagatcccctgcaggggacaacaggtctcatccccctcctcggcattgac
gtatgggagcacgcctattatcttcagtacaaaaatgtgcgccctgactacgtcaaagct
atctggaatgtaatcaactgggagaatgtgagcgatcgtctccagattgccaaaaagtag

DBGET integrated database retrieval system