KEGG   Nothobranchius furzeri (turquoise killifish): 107378328
Entry
107378328         CDS       T05163                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04080  Neuroactive ligand-receptor interaction
nfu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107378328 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107378328 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nfu04030]
    107378328 (lpar2)
G protein-coupled receptors [BR:nfu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107378328 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107378328
NCBI-ProteinID: XP_015803955
LinkDB
Position
sgr05
AA seq 368 aa
MAENKQNTCYYNHNVTFFYNQVGKEMSEKWTPRDFVVIGLGLTVCVIVVLANLLVMVAIF
KNRRFHFPIYYLLGNMAAADLFAGLAYANLMLNTGPWTPTLTKQQWYIRGALIDITLTAS
VANLLAVAVERHQTIITMQLHSNMTKRRVVLLIVCIWAAGIIMGLVPSLFWNCECDLKDC
STVAPLYSRRFLVFWAVLNLLTFFVMVAMYSRIFYYVKCQSRQTAQHTSEIRQNQTVVNL
MKTISMVLGAFVICWTPGLITLLLDGLLGKDGNANSYEKYCLVVAECNSLVNPVIYSLRD
DEMRRTFKWILCRLCQRGADRQQDASPAEINSPLTEKTLECALQLEDQALWKPRDTDFSD
NRWTEPVV
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggctgaaaacaagcagaatacctgctactacaaccacaatgtcaccttcttctacaac
caggtggggaaggaaatgagtgaaaagtggaccccgagggacttcgtggtcatcggactt
ggattgacggtgtgtgttattgtagttttggcaaacctgctggtgatggtagccatcttc
aagaaccgccgcttccacttccccatctactacctcctagggaacatggcagcagcagac
ctgtttgcaggtcttgcctacgccaacctgatgttgaacacgggcccttggactccaacg
cttacgaagcagcagtggtacatccgcggggctctgattgacatcaccctgactgcctct
gtggccaacctgctggctgttgctgtggagcgccaccagaccatcatcaccatgcagctg
cacagcaacatgaccaagcggcgcgtggtgctgctcatagtctgcatctgggctgcagga
atcatcatgggtctggttccctccttgttttggaactgcgagtgtgatctaaaagactgc
tctacagtggcaccgctgtacagccgccgcttcctcgtcttctgggccgttctcaacctg
ctcactttcttcgttatggtggcaatgtactcccgcatcttttattacgtgaaatgtcag
agtcggcagacggcccagcacacctctgagatccgacaaaaccagacggttgtcaacctg
atgaaaaccatctcgatggttctgggggcctttgtaatctgctggacacctggcctcatt
accctcctgctggacgggctgctgggtaaagacggcaacgccaacagctacgagaagtac
tgcttggtggtagcagagtgcaactctctggtgaatcctgtcatttattctctgcgggac
gacgagatgcggcggacgttcaagtggatcctgtgtcgtttgtgtcagagaggtgctgat
cgacagcaggatgcttcccctgctgagatcaactctccactgacggagaaaactcttgaa
tgcgccctgcagttagaagatcaggccttgtggaaacctcgggatacagactttagtgac
aacagatggacagagcccgtggtctga

DBGET integrated database retrieval system