KEGG   Nothobranchius furzeri (turquoise killifish): 107378443
Entry
107378443         CDS       T05163                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04068  FoxO signaling pathway
nfu04217  Necroptosis
nfu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107378443 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107378443 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107378443 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107378443 (stat3)
Transcription factors [BR:nfu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107378443 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2
Other DBs
NCBI-GeneID: 107378443
NCBI-ProteinID: XP_015804137
UniProt: A0A1A7ZPR7
LinkDB
Position
sgr05
AA seq 787 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
TVSQNGQAAHPTGTIVTEKQQVLEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMVQLEQMLTALDQLRRQIVTDVGGLLTAMDYVQKNLTDEE
LAEWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDIGGKTQIQSVEPYTKQQLSNMSFADIIMGYKI
MDATNILVSPLVYLYPEIPKEEAFGKYCRPEAAHEPEAGGDSTSTIQPYLKTKFICVTPC
PSVFMDLPDSEPLGSGFLGTNSGNTSDLFLMSPRTLDSLDSLMPSEAEANQGHLDSLTLN
MDVASPM
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtatttggagcaactataccac
ctgtatagtgacagcttccctatggagctacggcagttcctcgccccctggattgagagt
caggactgggcttacgctgctaacaaggagtcacatgccacattggtgttccacaacctc
ttgggggaaatagaccagcagtatagccgcttcctgcaggagaacaatgtcctctatcag
cacaacctgcgcaggatcaaacagcacctgcagagcaaatatctggagaagccgatggac
attgcccggattgttgctcgttgtttgtgggaggagcaaaggctgctgcagacagccacc
actgtttcacagaacggccaggcggcccatcccactggaacaatagtgacagagaagcag
caagttttggagcacaaccttcaagacatcaggaagcgggtgcaggacatggaacagaag
atgaagatgcttgaaaacttgcaagatgattttgactttaattacaaaaccctgaaaagc
caaggcgagctgtcccaagacctaaacggaaatagccaggcagctgccactcgacagaag
atggttcagctggagcagatgctgacagccttagaccagctcaggaggcaaatcgtgaca
gatgtgggaggcctgctgactgccatggattatgtacagaagaatctaactgatgaggaa
cttgcagaatggaaacgaaggcagcaaatcgcctgcattggaggcccaccaaacatctgc
ctcgatcgtctcgaaacatggatcacatccttagccgagtcccagctccagattcgtcaa
cagatcaagaagctggaggagcttcagcagaaggtgtcctacaaaggagaccccatcatt
cagcaccggcccgccctggaggagaagattgtggatctgttcaggaacctcatgaagagt
gcctttgtggttgaaaggcagccgtgtatgcccatgcacccagacagacccctggtcatt
aaaacaggggtgcagttcacaactaaggtcaggctactggtgaagtttcctgaactcaat
taccagctcaaaattaaagtctgcattgacaaagaatctggtgacgtggctgcaattaga
ggatcacgaaagtttaacatccttggtaccaacacaaaagtcatgaacatggaggaatcc
aacaatggcagcctttctgctgagttcaaacacttgaccttgcgggaacagagatgtggt
aacggtggccggactaatagcgatgcttctctcattgtaacagaggaactccatcttatc
acctttgagacagaagtctaccaccaaggcctgaagatcgatctggagactcattccctg
cctgtggtggtgatttcaaacatctgccagatgcccaatgcctgggcttccatcctgtgg
tacaacatgctcaccaatcacccaaagaatgtgaatttcttcaccaagcctcccgtggga
acctgggaccaggtggctgaggtgttgagctggcagttctcctcaaccaccaagagaggc
ctgaccatcgagcagctcaccacactggctgagaaattactcggaccttgtgtaaactac
tccggatgccagataacatgggccaagttctgtaaggaaaacatggctggcaaaggcttc
tccttctgggtgtggctggacaacatcattgacctggtgaagaagtacatccttgctctg
tggaatgaagggtacatcatgggttttatcagcaaggagagagagagggccattctgagt
cctaaacctcctggcactttcctgctgcgcttcagcgagagcagcaaggaggggggcatc
acgttcacctgggtcgagaaagacatcggcgggaagactcagatccagtccgtggagcca
tacaccaagcagcagctcagcaacatgtctttcgctgacatcatcatgggctacaagatt
atggatgccaccaatattctggtttcgcctctcgtttatctctatcccgagattcccaaa
gaggaggcttttgggaaatactgcaggcccgaagcggctcatgaacctgaggcaggagga
gactcaacgagcactatccagccatacctaaagacaaagttcatctgtgtcaccccgtgt
ccctccgtgttcatggacttgccagacagtgagccgcttgggagcggattccttggcacg
aactctggaaacacgagtgacctgttcctcatgtcaccgcgcaccctggactcgctcgac
tccctgatgcccagtgaagctgaagccaaccaaggacatctggattccctcactttgaac
atggatgtagcctctccaatgtga

DBGET integrated database retrieval system