KEGG   Nothobranchius furzeri (turquoise killifish): 107378477Help
Entry
107378477         CDS       T05163                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04210  Apoptosis
nfu04625  C-type lectin receptor signaling pathway
nfu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107378477
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107378477
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107378477
   04672 Intestinal immune network for IgA production
    107378477
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107378477
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107378477
Protein kinases [BR:nfu01001]
 Serine/threonine kinases: STE group
  Other
   107378477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal CCDC106
Motif
Other DBs
NCBI-GeneID: 107378477
NCBI-ProteinID: XP_015804194
LinkDB All DBs
Position
sgr05
AA seq 888 aa AA seqDB search
MSNPSDEMAVSQRLFNSTSPFSDSPKAEVKGSYPSCSSVEQETEEGKGPKNGSVRIKEWV
SKLLTHGTAETVGEEPIKTSTIIAQAECETQDSQEFSPSSHERSYVPSPNCFISSLSSEH
NNVACPAPASIQQPSCSSVSFTQRKKSRRKPKSKGRKKQEKRKETQRQRHRTPSGVPEQE
SGSSVGLIQEELSLSGRRELSASCCSSVESLVEQDQTHTLYTRPAFNTDSSCAVLNWPNS
SLRRISSLHSYEDDRSSDSLSTLGSCSLALAGLRGSVSQADPCYAGPFFRDVENDVKESE
DEFSADDSHRNEGIIFFNEKFQLVDSEYKEGSEYVLSHFIKQGSYGEVHGARDAQTGFEF
AAKKIALKRFSSEEVGAWSALRSPRVVELFGVIRDGPCVVLLMDQKSGSLGQLIMKRGRL
PEDLSLHYVSQVLTALEYLVKKKVAHLDIKADNVLLSEDGKDTFLCDFGHAEKLDSQGQS
LRGLKDLKGTETHMAPEIVKGEPRGAKADVWSSCCMLLHMLNGCEPWTRYYTCRLYLKIA
NDPPPVREIPPDCSPLTAEVLKAGLQKDPVKRSSASQMKNKTDRALKEVGGFTSPVKGPY
AEPLYVTSKSMQLPYSSDGSENGELHPESADKVTTAERKARKLNLGNENETGSRESKQGL
LFGPQVLISEPNQKWGNKVTTLPELELRKLERDFYLSSLSQLHSAEMQEQLLSCINSDIL
NWEPLDKKDSGRWSLSPADDFSSGFFSYNSQSDAQVLSTDLLGQTPFRPPWCFQGKIKST
KKNIPPPDLPHTARVCSAVGSGVDVCIRDFSRRSIRIREKRRVKVGHIATGISDQISERV
FTLETLQGRQIAHNEEVLESGLELRCVPAPDFSSAWRWRIRDRVLETR
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacccttccgatgaaatggcggtgagtcagaggctttttaattctacgtctccg
ttctccgactcacccaaagccgaggtgaaggggtcttacccatcctgctccagcgtagag
caggagacggaggagggaaaaggccccaaaaatggctccgtgcgcataaaagaatgggtt
agtaaactcctgacacatgggacggcggagacggtgggagaagagcccataaagacctca
actatcatcgctcaggctgaatgcgaaacccaggactcccaggagttcagtccttcttct
cacgaacgcagttatgttccctctccaaattgtttcattagcagtctttcttctgagcac
aacaatgtggcatgtccagctccagcctccatccagcagccaagctgctcgtcggttagt
ttcacacagagaaagaagagccggaggaaaccgaagagcaaagggaggaaaaagcaggag
aagaggaaggagacgcagcggcagagacatcgaacgccctctggagtccctgaacaggag
agcgggagttctgtaggcctgatccaggaggaattgtccctgagtgggagacgcgagctc
agcgcgtcctgctgcagcagtgtcgagagcctggtggagcaggatcagacacacactctc
tacaccagaccagccttcaacaccgactccagctgtgctgttctgaactggcctaactcg
agtttgcgccggatctccagcctccactcctatgaggatgacagaagctcagactccctc
agcactctgggaagctgctccctcgccctcgccggcctgagaggcagcgtcagccaggcc
gacccctgctatgcaggacccttcttcagagatgtggaaaatgacgtaaaggagagtgaa
gacgagttctccgcagacgattcacatcgcaacgaaggaatcattttttttaatgaaaaa
tttcagcttgtggactctgagtacaaagaaggcagtgagtacgtcctgtcacattttatc
aaacaaggctcttatggagaagtacacggcgctcgagatgcccaaacaggattcgaattt
gcagccaaaaagatcgccctgaagaggttcagcagtgaggaggtgggtgcgtggagtgcc
ctcagatctcctcgtgtggtggagctcttcggagtcatccgagacgggccctgtgttgtc
cttctgatggaccagaagtctggctccttgggccagctgataatgaagcgtggccgactg
cctgaagatctaagtctgcattacgtctctcaagtcctaacagcactggagtacttggtg
aagaagaaggtggcacatttagatattaaagctgataacgtgttgctgtcagaagatgga
aaggacaccttcctgtgcgactttggtcacgcagagaaactggacagtcaggggcagagc
ctcagagggttgaaggacctgaagggcaccgagacccacatggcccctgagattgtcaaa
ggggaaccccgtggagccaaagcagatgtgtggagcagctgctgcatgttactgcacatg
ctcaatgggtgtgagccatggacaagatactacacctgtcgactctacctgaagattgcc
aacgatcctcctcccgtcagagagatcccacctgactgcagcccgctcacagctgaagtt
ttaaaggctggactccagaaggatcccgttaagagatcatcagcatctcagatgaaaaac
aagactgacagagctcttaaggaagttggaggttttaccagtccggtcaagggtccctac
gcagagcctctgtatgttaccagtaaatcaatgcagctcccttatagcagcgatggctct
gagaacggagagctgcacccggagtcggccgacaaagtgaccaccgcagaacggaaggct
cggaaactaaatcttgggaacgagaatgaaaccggctcacgcgaatcaaaacaagggttg
ctctttggtccacaagtgctgatttctgagccgaaccaaaagtggggcaacaaagtcacc
acgttgcccgagctggagcttcgtaaactggagcgagacttttacctcagcagcctgtct
cagcttcattctgctgagatgcaggagcagctgctgtcctgcatcaacagcgacattctc
aactgggaaccgctggataaaaaggactctggccgctggtccctcagcccagcagacgac
ttcagctccggcttcttctcctacaacagccaatcagatgctcaggtcttgagtacggat
ttgttgggtcaaacaccgtttcgaccaccctggtgttttcaaggtaagataaaatccaca
aaaaaaaacatccctccacctgatttaccacacactgctcgtgtgtgttctgctgttggg
tcaggggtggatgtctgcatcagagacttcagcaggagaagcattcggatcagggagaag
cggcgcgtgaaggttggccacatcgccactggaatcagtgatcagatttctgagcgggtg
ttcaccctggagacccttcagggtcggcagatcgctcacaacgaggaggtgctggaatcc
ggactagagctgcgctgtgttcctgctccagacttcagctctgcatggaggtggaggatc
agagaccgggtgctggagacacgctag

DBGET integrated database retrieval system