KEGG   Nothobranchius furzeri (turquoise killifish): 107378497Help
Entry
107378497         CDS       T05163                                 

Definition
(RefSeq) uncharacterized protein LOC107378497
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107378497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nfu03036]
    107378497
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107378497
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107378497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107378497
NCBI-ProteinID: XP_015804228
UniProt: A0A1A7ZBM7
LinkDB All DBs
Position
sgr05
AA seq 2032 aa AA seqDB search
MDGCTRMSVKELCETDDLATSLVLDPLLGFSTHKMNISPPPEVRRWGNLKETLLRFQRTH
DFDATFEALTVGELAGDYFNALGSHRQELLRQHVYRYLSAFLLDSGIRIESCDRYSSETN
GAKITSTRHWFVGERVEVLLGCIAELSLADSTVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFLPGEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFKHKGKQPECEETKDPVGQKYRLRERFLRHHRERGYFASRPITPGIHSGIFKAIPSRN
SFTQQMRRNALKNKKLNETKKWRREKQRWSGKLPLKSSTIKRCRTLPLLSQVTLKDVRVR
VRRHSLDFLLNCKNPKSRERALLQQLEEVKPNSVKQVKSTGEENDSSAVNLMPFTAGPSM
LANQKRRPVGRGVGLGESPVKVVDRPAARRRKSSKTKSMAARRQRSKMESSNTDSAGAVT
GSRPVQDDQTCCTKTPEATDKAITESQSNNSGSTKPSIVTGVKNPGTKQNVTEASPNLTN
CQNVSHGSENAAANPMVSLKQYVTVNLTRLSLPQGLEPGKPGGDGKRCVAKRRNKPGPKA
SALKEKPVIVADGCAAEGKRGAKEVVVKAKDQGSAGKQHPAVEVTDPSHDEKRHADEASE
AQTVSSEQKGDEQQEQPTVVKDKTDEQDNKTVPGTNAVECQRAVEVKESECNVVSREVKK
RQSNTQSKRKGGCKRQKVGNDVSGETEQMKKSLMEPPVSRKEDTIFIKQAKVLLSDILKK
DKTLIYRKLRGDVGVEFCRTSKEMLSTEQEVEQGEIKEGDGLCPVNGLKGRQMRPRSVKK
NVNDKQSTKGHLSKEVPVSVKAVNEKACPLQPEQRHSEPLTACLNPLPPRSPLSAKASLH
PDTNLQLHTQSNIPLKKRTFRSSLEIDSEQSLNLTSEAVLKKTPESSSPSAPKQSSASCL
GDGGKVRRENKVKTASKRVPKQPSFNKTLRSRPNVAQRGHLVRKVQKCKVGKQDDSKALT
PLCDDPAEDKTPEVKPKIKQKCAKSSSSQDYSTEEQYSEQTESACDFKIRLKRRRGKVWE
MENERMALKSEKEEDLTECDPFKAIMDSVSILNMEMEAHMQASKKPKSRLDRLKRRREQA
VENQPALLSADVKPGCEDKFRPNESTSGKREIIETFDGVQKVSEKAESPASSNGTFSAFE
QETKMEDRFLNHFCLFESGSQQKLEPELGLNGLPLPVIKLRRKAEDIWEVDSKKGLIQAD
LLESNIKKEIKTQAPGKQKKGCLDSGTLKAECPSNQRVNGKPAANKTEAPPFSLSLSPLS
LSSPLNYNNAEAFPAADRSAERSEMNREGRKPRQKTDGSRKCGPVETPTTCLSHTLQQID
NSLSRLSEGLCSSQTLEKPATCSSASSSVIQTPSQSPPFTTADSMLTGEPNFTNCCDDIL
DFQCLNFEGYYQPQNILPSSPSDLCSLDPPTDPFSSPLSHSPSDTWNTETPYLGPPSPEN
NFNSEDLQFFPGLISSKSDAGSVQSGGKDAAKDRHAPNPGFGFSAPGNSDLTGKDRNISR
HLGMRLSKEDPKTPSLSVVNKPRFLGSTSSSVTSQNPVSLTQTSINMKPSGSQPKTQLNL
KTQGPFHRMTVPSKSQSFPSSQPNTGSGVSAQTSNRFPSPQLFSAKNPNPPESPFSFLEK
PSTVIHRVLKFQGGNQSQNLYSAPCKETLAAGSSTVMSRALGPKSNEVQKTQQSQKLGVY
TERPQKSDASAPGFGKDLGHLCTSTNVSRSNINFNKPNSSVLQSFSKNKIPSDKQEGGET
NMMYRNFSDLPRPFFFPSKGSDCYPSPQNKSLKGDRTTASSSDKHQLCYTQQDAFDFSFS
SSLSPMSQHSSPQVAHSTPPGTPAPANKSQSSTTSASFPYGCQGPPYVLNFSGDHSLTLG
LRDGTEGYTGLGPTNYTYHCLMEPSGTQGRLVLEPCGPQLQNMSSMGGFAGVKGQDDHCR
RDMQQQCQPGEHQGVPHYGPVPGSHSMGPTKPKRVRLVVTDGTVDLDLQYSD
NT seq 6099 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtgcactagaatgagtgtgaaggagctgtgtgagaccgatgacctggccacc
agtttggtgctggacccgcttctgggcttcagcacccataaaatgaacatcagtccccct
ccagaggtccggcgttggggcaacctcaaagagacgctgttgcggtttcagcgcacgcat
gactttgacgccacgtttgaggctctgactgtcggagaactggccggtgattactttaat
gctctgggaagccatcgacaggagctgctgagacaacatgtgtatcgctacctcagtgcc
ttcctgctggatagtggcatcaggatagagtcctgtgacagatactcctcggagactaat
ggagcaaagataacatcaacaaggcactggtttgttggagaacgcgtggaggtcctactg
ggctgcatcgcagagctgagcctcgccgacagcaccgtgctgagggcaggggtcaacgac
ttcagcgtgatgtattccacacgcaagcgctgcgctcagctctggctcgggccggcggcg
tttatcaaccacgactgcaagcccaactgcaagtttctcccaggtgagaaaaatatcgcc
tgtgttgaagtgattcgacccatatcacctggggaggagatcacctgttactatggtgcc
agcttttttggcgaaggcaatgaaatgtgtgaatgctgcacctgtgaaaggaatggagag
ggtcacttcaagcataaggggaagcagcctgagtgcgaggaaacaaaggaccccgtgggt
cagaagtaccgcctgagagagagatttctccgccaccacagagagagaggttactttgct
agcagaccgataactccaggaatacactctgggattttcaaagccatcccttcgaggaac
tccttcacccagcagatgaggaggaatgccttgaagaacaaaaagctgaatgaaacaaag
aagtggaggcgagagaagcagagatggtcaggaaagctgccgctgaaatcctccacgatt
aaacggtgcaggacgctcccacttctgtcccaggtcacgctgaaggacgtcagggtcaga
gttcggcgtcactctctggattttcttcttaactgtaagaatcccaaaagcagagagagg
gccttgctgcagcagctcgaggaagtgaagccaaactcagtgaagcaagtgaaatccacc
ggtgaagaaaatgacagcagtgcggtaaatttgatgccctttactgcaggcccctccatg
ttggcgaatcagaagcgtagacctgtaggacgtggcgttggacttggtgagagtcctgtc
aaagtggtggacaggccggcagctcgcaggaggaaatcttcaaagacaaaaagcatggcc
gcaagaagacagcggtccaagatggagtccagcaacacagactctgctggtgctgtaaca
gggtctcggcccgttcaggatgatcaaacctgctgcacaaaaacgccggaggcgacggac
aaagcaatcactgaaagtcaaagcaacaacagcggcagcaccaaacccagcatcgtcacc
ggggtaaagaacccaggtactaagcaaaatgttaccgaggcttcgcccaatttaacaaac
tgtcagaatgtctcacacgggtcagagaatgctgcggccaatccaatggtatccctaaag
caatacgtcacagtaaaccttacacggctgtcgttgccacaaggtctagagcccggaaag
cccggtggagacggaaaaagatgtgttgcaaaaagacgaaacaagccgggtccgaaagcg
tccgctctaaaagagaaacctgtcattgtggcagatggctgcgcggctgagggtaaaaga
ggagcgaaggaggtggtggtcaaggccaaggatcaaggaagtgcaggaaagcagcatcca
gctgtggaagtgacggatccctctcatgatgagaaacggcacgctgacgaggcttctgaa
gctcagacggtgtcgagtgagcagaaaggtgacgagcaacaggagcagccgactgttgtg
aaggacaaaaccgatgagcaggacaacaaaacggttcccgggacaaacgctgtagaatgc
caaagagctgtggaagtgaaagagtctgagtgtaacgtggtgtccagagaagtaaaaaag
agacagagtaacacccagagtaaaaggaagggtggatgtaagcggcaaaaagtaggtaac
gacgtatcaggagaaacggaacaaatgaaaaagagtttgatggaaccaccagtgagcagg
aaggaggacaccatttttataaaacaagcaaaagttctgctgtcggacattttaaagaag
gataaaaccttaatatacaggaaactgaggggagacgtcggggtagagttctgcagaaca
tctaaagaaatgctgagtactgaacaggaagtggaacaaggcgaaataaaggaaggcgat
ggcctctgcccagttaacgggttgaaaggaaggcaaatgcgtccgagatcagtgaaaaaa
aacgtaaatgacaagcaaagcaccaaaggacacttgagcaaagaagtccccgtctcagtg
aaggccgtgaatgaaaaagcatgtccacttcagcctgagcagaggcacagtgagccactg
actgcctgcctcaacccactacctccaaggtcaccgctttcagctaaagctagccttcat
ccagacactaatctacagctgcacactcagtccaacatacctctgaagaaacgtactttt
cgcagttcccttgaaatagactctgaacaaagtctgaacttgacctcagaagccgttctc
aaaaagactccagagtcaagttccccttcagctccgaaacagagctctgcatcttgttta
ggagacggtggcaaagtaagaagagagaataaagtcaagacggcttccaaacgagtccca
aaacaaccctccttcaacaaaacgcttcgctccagacccaatgtagctcagcgaggacac
ctagtgaggaaagttcagaaatgtaaagtgggaaagcaggatgacagtaaggctctcacg
ccactgtgtgatgatcctgcagaggacaaaacaccagaggttaaacccaaaatcaagcaa
aagtgtgctaaaagttcatcctcacaagattattccactgaggagcaatattcagagcag
acagagtcggcgtgcgatttcaagatccgcctcaagagaagaagagggaaggtgtgggag
atggaaaatgaaagaatggccctgaaatcagagaaagaagaggatttaacggaatgcgac
ccttttaaagccataatggattctgtttcaattttaaacatggagatggaggctcacatg
caggccagcaaaaagcctaagagcagattggatcgtctgaaacgaagacgagagcaagcc
gtggaaaaccagcctgctcttctctctgctgatgttaaacccggctgtgaagacaaattc
cggccaaacgagtcaacgagtggaaaaagagaaattatagagacgtttgatggagttcag
aaggtttctgagaaggctgagagtccggccagcagcaacgggacgttttcagcgtttgag
caggaaactaaaatggaagaccgtttcttaaatcacttctgcttgtttgaaagtgggtcg
caacaaaaactggagccagaattgggtttaaatggtctcccgttacccgtaataaaactc
aggagaaaggcagaggatatctgggaagtggacagtaaaaagggtctcattcaggctgac
ctattagagtccaacattaaaaaggaaataaagactcaggctcctggaaaacaaaagaag
gggtgccttgactcgggtacgctcaaagccgagtgtccatccaatcagagagtaaacggc
aagccagctgcaaataagacagaagcgcctccattctcattgtccctgtcacctctgtcg
ctctcttcaccactaaactataacaacgccgaagcttttccagctgcagatagaagtgcc
gaaaggtcagagatgaatagagaagggagaaaaccgaggcaaaagacggacggatcacgc
aagtgtgggcctgtggaaacgcccaccacttgccttagtcacacacttcaacagatcgat
aacagcctctcgaggctctctgaaggattgtgttcttcacagacgttggaaaaacctgca
acctgttccagtgcctccagttcggtgattcagaccccgtcccagtcccctcccttcact
actgctgacagcatgctcacaggcgagcctaacttcactaactgctgtgatgatatcctc
gactttcagtgtctcaactttgaggggtactaccaaccacagaacatactcccatcttca
ccctcagatctgtgttctctggatccacccactgaccctttcagcagccccttgtcccac
agcccctctgacacctggaacactgaaacaccctatcttggccctccaagtccagaaaat
aactttaacagcgaggatttgcagttttttccaggtctaatttcttccaaaagtgatgct
ggttctgttcaaagtggaggtaaggatgctgccaaagataggcatgcacccaaccctggt
tttgggttttcagctccagggaactctgacttgacgggcaaggaccgaaacattagcaga
catctaggaatgaggctttccaaagaagaccccaaaactccatctttgtctgttgttaat
aagccacgttttttgggttcaacctcatcttctgttacatctcaaaatccagtttcttta
actcagacgtccatcaacatgaagcctagcggcagccagcccaaaacccagctgaacctc
aaaacccagggcccgttccatcgtatgaccgttccaagtaaatcccagtcttttcccagc
agccagcccaacacgggtagtggagtctcagcacaaacatccaacagatttccctctcct
cagctcttctctgctaaaaatcccaatccacccgaaagtccattcagcttcctagaaaag
ccctctacagtgatccacagggttctcaagtttcagggagggaaccagagccagaacttg
tatagtgcaccatgcaaggaaaccttggctgccgggagctcaactgtcatgtccagggca
ctcggcccaaagtcaaatgaagtccaaaagacccagcaaagtcagaaattaggtgtttat
actgaacgtcctcagaaaagcgacgcttctgcccctggatttggtaaggatcttggccac
ctttgtacctccaccaatgtcagcaggtctaacattaatttcaacaaacccaattcttcc
gttttacaatcattcagtaaaaataagataccatctgacaagcaagagggcggtgaaacc
aacatgatgtacagaaacttctcagacctgccgagaccatttttctttcccagcaaagga
tcagattgttacccatcaccacaaaacaagagtttgaaaggggacagaactactgcgtcc
tcctctgataaacaccagctgtgttacacacaacaagatgcatttgatttcagttttagc
tcctcactttcgcccatgtctcagcacagcagcccccaagtggcccacagcacacctcct
ggtacaccagcaccagccaacaagagccagtcctccaccacctcagcttctttcccttac
ggctgtcagggtcctccctatgtgctgaatttcagtggggaccattcactgaccctgggt
ctcagggatggtacagagggctacacaggtttaggcccaacaaactacacttaccactgc
ctgatggaaccttcaggcactcaggggcggctggtccttgaaccctgtggaccccagcta
cagaacatgtcctccatgggtggattcgcaggcgtcaaaggtcaggatgaccattgcaga
agggacatgcagcagcagtgccagcccggggaacaccaaggggtaccgcactacggacca
gttccaggatcacactccatgggtccaacaaaacccaagagagtgaggctggtggtgact
gacggtacagtggacctggacctgcagtactcggactaa

DBGET integrated database retrieval system