KEGG   Nothobranchius furzeri (turquoise killifish): 107378799Help
Entry
107378799         CDS       T05163                                 

Gene name
ctnnb1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04310  Wnt signaling pathway
nfu04510  Focal adhesion
nfu04520  Adherens junction
nfu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107378799 (ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107378799 (ctnnb1)
   04520 Adherens junction
    107378799 (ctnnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107378799 (ctnnb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 107378799
NCBI-ProteinID: XP_015804692
UniProt: A0A1A7ZDL6
LinkDB All DBs
Position
sgr05
AA seq 782 aa AA seqDB search
MASQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEDDVDNN
QVMYEWEQGFNQNFSQDQVQDIDGQYAMTRAQRVRAAMFPETLEEGMQIPSTQYDTANPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDVDEVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTSDIETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPIDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLSKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTFTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNFKNKMMVCQVGGIEALVRTVLRAGDREDITEPAVCALRHLTSRHQDAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREHGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDLHNRVVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEVADAIEAEGASAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEMAWNETGDLGLDIGAQGEPLGFRPDDPSYRPFHA
GGYGGDSMGMEPMMDHDLGGGHHPAQDYPPVEGLPDLGHSQELIEGLPTGDSNQLAWFDT
DL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccaagctgatctgatggaactggacatggccatggagcctgaccgtaaagca
gcagtcagccactggcagcaacagtcctacctagactcaggcatccattcaggagccacc
acaacggccccttccctcagtgggaagggcaatccagaggaagatgatgtggacaacaac
caggtcatgtacgagtgggagcagggcttcaaccagaacttctcccaggaccaagtacaa
gacatagatggtcagtatgccatgacgcgggctcagagggttcgggcagccatgtttcca
gagactcttgaggagggcatgcagatcccctccacacagtatgacactgcaaaccccact
aacgtccagaggctggccgagccgtcgcagatgctcaaacacgccgtggtaaatctgatc
aactatcaagacgacgcggagctcgctaccagagcaataccggaactcaccaaactactc
aacgatgtggacgaggttgttgtaaacaaagcagcagtgatggtccaccagctgtcaaag
aaagaagcctcccgccacgccatcatgcgctcccctcagatggtgtctgccatcgtcagg
accatgcagaacacgagtgacatcgagacggctcgctgcaccgccggaacgctgcacaac
ctctcccaccacagagaggggctgctggccatcttcaagtccggagggatcccagctcta
gtgaaaatgctcggctcaccgatagattcagttctgttctacgccatcaccaccctccac
aacctcctcctgcaccaggaaggagccaagatggctgttcgcttagctggcgggctacag
aaaatggtggctcttctcagcaaaactaatgtaaagttcctggccatcaccaccgactgt
ctccagatactggcctatggaaaccaggagagcaagctcatcatcctggcgagcggcggt
cctcaagcactggtcaacataatgaggaccttcacctacgagaagcttctgtggaccaca
agccgtgttctcaaagttctgtcggtgtgttccagtaacaaacccgccatagtagaagcc
ggaggtatgcaggctctgggactacacctgaccgatcccagtcagagactggtccagaac
tgtctgtggaccctcagaaacttatcagacgctgccaccaaacaggagggaatggagggt
cttctaggaactctggtccagctgctcggcagcgatgacatcaacgtggtgacctgtgct
gctggcatcctgtccaatctgacctgcaacaacttcaaaaacaagatgatggtttgtcag
gttggaggtatcgaggcgttggtccgcacagtgctgcgggcgggagacagagaagacatc
acagagccagctgtatgtgctctgcgtcacctcacatctcgacaccaggatgcagagatg
gcacaaaacgctgtccggctgcactacggcctgccggtggtcgttaagctgctgcaccca
ccctcacactggcctctcatcaaggctacagttggtctaatccgaaacctggctctgtgc
cccgccaaccacgccccactgagggagcacggcgccatccccagactggttcagctgctg
gtccgagctcaccaagacacgcagagacgcaccagcatggggggcacgcagcagcagttt
gtggagggcgttcgtatggaggagatcgtggagggctgcactggagcgctgcacatcctg
gccagagacctccacaacagggtggtcatcagaggactcaacaccatcccactctttgtt
cagctgctgtattcgccaatcgagaacatccagcgtgtggcagcaggcgtcctgtgtgag
ctggcccaggataaagaggttgctgatgccatcgaggctgaaggagccagcgcccctctc
acagagctgctgcacagccgcaacgaaggagttgctacgtacgccgctgcagttctgttc
cgcatgtctgaagacaaaccccaggactacaagaaacgtctctctgtagaactcaccagc
tcactgttcaggacagaaatggcctggaacgagacaggagacctgggcttggacatcgga
gcacagggagagcctctgggcttcagaccagacgacccaagctaccgtcccttccatgcg
gggggctacggaggggactccatgggtatggaacccatgatggaccatgatttgggtgga
ggtcaccacccagcacaagactacccccctgtagaagggctgcctgacctgggacattcc
caggaactgatagagggcctgccaactggtgactcaaaccaactggcctggtttgatact
gacctgtaa

DBGET integrated database retrieval system